Details for Chinese cabbage Locus Brara.G03553

Position : A07 ( 5`- 26493766 .. 26497975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03553

Protein [Map View]
MAKMILLLLILFFLHGVDSSPPHACDASNPTTKLFQFCRTDLSVNRRARDIVSRLTVDEKISQLVNSAPGIPRLGVPAYQ
WWSEALHGVADVGPTPGIRFNGTVKAATSFPQVILTAASFDSYLWFRIAQVIGKEARGVYNAGQAKGMTFWAPNINIFRD
PRWGRGQETPGEDPTVTGAYAVAYVRGLQGDSFDGKKTLSGGHLQASACCKHFTAYDLDRWKGITRYVFNAQVSLADMAE
TYQPPFKKCIEEGRASGIMCAYNRVNGIPSCADPNLLTRTARGLWHFNGYITSDCDAVSIIYDDQGYAKTPEDAVADVLK
AGMDVNCGSYLQNHTKSALQQKKVSEADINRALINLFSVRIRLGLFNGDPTKLTYGNISPNDVCSPSHQALALEAARNGI
VLLKNPLKLLPLSKRSVSLAVIGPNAHVAKTLLGNYAGPPCKNVTPLDAIRGYVKNAVYHKGCDSVACSNAAVEQAVAIA
RSAERVVLIMGLDQTQEKEDMDRVDLSLPGKQRELITSVAKAAKKPVVLVLICGGPVDVSFAKDNDKIGSIVWAGYPGEA
GGVAFAEILFGDHNPGGRLPVTWYPQNFVDVKMTDMRMRSSSSGYPGRTYRFYKGPKVFEFGHGLSYTTYSYSFKSLTQN
TLYLNQSKPQTNSDSLRYALVSEMGRESCDTAKTKVSVMVENQGEMAGKHPVLMFMRHEKGGEDGTRAEKQLVGFQSVVL
SKGEKGEVEFEIGVCEHLCRANEIGVMVVEEGKYFLTVGDSELPLTVNV*

DNA
ATGGCTAAAATGATTCTTCTCCTCCTCATTCTCTTCTTCCTTCACGGCGTTGACTCATCTCCGCCGCACGCTTGCGACGC
ATCGAATCCCACCACGAAACTCTTTCAGTTCTGCCGCACCGACCTCTCGGTTAACCGGCGAGCTCGCGATATCGTCTCGA
GGCTAACAGTAGACGAGAAGATCTCTCAGCTTGTAAACTCAGCTCCAGGGATACCTCGCCTTGGAGTGCCGGCGTACCAA
TGGTGGTCGGAGGCTTTACACGGCGTAGCTGACGTCGGTCCGACTCCTGGGATCCGGTTTAACGGAACGGTTAAAGCTGC
CACTAGCTTTCCTCAAGTCATCCTAACCGCAGCTTCCTTTGACTCTTATCTATGGTTCCGCATTGCTCAAGTAATAGGAA
AGGAAGCAAGAGGAGTGTACAACGCAGGGCAAGCGAAAGGGATGACGTTTTGGGCACCGAACATCAACATATTTAGGGAT
CCACGGTGGGGAAGAGGCCAAGAGACTCCTGGCGAGGATCCGACGGTGACCGGAGCTTACGCGGTGGCTTACGTCAGAGG
ACTCCAAGGTGATTCTTTCGACGGTAAGAAAACACTCTCTGGTGGTCACCTTCAAGCCTCCGCTTGTTGTAAGCATTTCA
CGGCTTATGATCTTGACCGTTGGAAAGGTATCACCCGCTACGTTTTCAATGCTCAGGTGAGTTTGGCTGACATGGCGGAG
ACTTACCAACCACCGTTCAAGAAATGCATAGAAGAAGGCAGAGCCAGTGGCATCATGTGCGCTTATAACCGAGTCAACGG
CATTCCCTCTTGCGCTGACCCAAACCTCTTGACTCGAACCGCTCGTGGTCTCTGGCACTTCAATGGATACATTACTTCAG
ACTGTGACGCAGTCTCAATCATCTACGACGACCAAGGCTACGCCAAGACCCCTGAAGACGCAGTCGCTGACGTCCTCAAA
GCCGGCATGGACGTAAACTGCGGGTCATACTTACAAAACCACACCAAGTCAGCTCTCCAGCAGAAAAAAGTGTCGGAAGC
AGACATCAACAGAGCTCTAATCAACTTATTCTCCGTTAGGATCCGTCTCGGTCTCTTTAACGGCGATCCAACAAAACTAA
CTTACGGAAACATAAGTCCTAACGACGTTTGTTCTCCGTCTCATCAAGCATTAGCACTCGAAGCAGCCCGTAACGGTATC
GTCCTTTTAAAAAACCCTCTTAAACTCCTCCCTCTCTCCAAACGCAGCGTTTCGTTAGCTGTGATCGGTCCAAACGCTCA
CGTGGCTAAAACGCTTCTCGGAAACTACGCTGGCCCGCCATGCAAGAACGTGACGCCTCTAGACGCGATACGCGGTTACG
TCAAAAACGCTGTTTACCATAAAGGATGCGACTCCGTGGCTTGCTCTAACGCTGCGGTTGAGCAAGCGGTGGCCATCGCG
AGAAGTGCTGAGCGCGTGGTCTTGATCATGGGACTAGACCAGACTCAAGAGAAGGAAGATATGGACCGTGTTGACCTTAG
TCTTCCGGGGAAGCAACGTGAGCTTATAACAAGCGTTGCTAAAGCTGCGAAGAAACCAGTGGTTCTTGTCTTGATATGTG
GCGGTCCTGTCGATGTCTCGTTTGCTAAGGATAACGACAAGATCGGCAGCATTGTTTGGGCTGGTTATCCTGGCGAAGCT
GGAGGGGTTGCTTTTGCTGAAATCTTATTCGGAGATCACAATCCTGGAGGGAGATTACCTGTGACATGGTATCCTCAAAA
CTTTGTGGATGTGAAGATGACAGACATGAGGATGAGATCATCATCATCTGGATATCCAGGAAGGACTTACAGATTCTACA
AAGGACCTAAAGTGTTTGAGTTTGGACATGGTCTCAGCTACACAACTTACTCTTACAGTTTCAAGTCTCTGACTCAAAAC
ACTCTCTACCTGAACCAGTCCAAACCTCAAACCAACTCAGACTCTCTCCGATACGCTCTGGTCTCAGAAATGGGAAGGGA
GAGCTGCGATACAGCCAAGACTAAGGTGAGTGTTATGGTTGAGAATCAAGGAGAGATGGCTGGGAAACATCCCGTGCTGA
TGTTTATGAGGCACGAGAAGGGAGGAGAAGATGGGACACGAGCTGAGAAACAGCTTGTCGGGTTTCAGAGCGTTGTGTTA
AGCAAAGGAGAGAAAGGTGAGGTTGAGTTTGAGATTGGTGTTTGTGAGCATTTGTGCAGAGCTAATGAAATTGGAGTTAT
GGTTGTTGAAGAAGGAAAGTACTTCTTAACCGTTGGAGATTCAGAGCTCCCTCTTACAGTTAATGTCTGA