Details for Chinese cabbage Locus Brara.G03552

Position : A07 ( 5`- 26491274 .. 26494577 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03552

Protein [Map View]
MATVVSHHLISSIASPHSPSNSKASLFPKEPFNLPIKFRQNRCFKIEATTASQTPVLDPLLSPSKTTPHKKKSNEASLIL
IRHGESLWNEKNLFTGCVDVPLTEKGVAEAIQAGKRISTIPVDLIFTSSLIRAQMTAMLAMTQHRCKKVPIILHDESEKA
QTWSHVFSEETRKQSIPVVAAWQLNERMYGELQGLNKEETAERYGTQQVHEWRRSYHIPPPKGESLEMCAERAVAYFEDN
IQPELALGNNVLIAAHGNSLRSIIMYLDKLTSQEVTSLELSTGLPLLYIFKDRKFMRRGSPVGPTEAGVYAYTKRLAQYR
QKLDESLN*

DNA
ATGGCTACGGTTGTGTCTCACCATTTGATCAGCTCTATTGCTTCTCCTCATTCACCTTCCAATTCCAAAGCTTCTCTCTT
CCCAAAGGAGCCTTTCAATCTCCCTATCAAGTTCAGACAAAACCGTTGTTTCAAGATCGAAGCAACAACTGCATCTCAAA
CTCCTGTTCTTGACCCTCTCTTGTCTCCTTCCAAGACAACCCCTCACAAGAAAAAATCAAATGAAGCATCACTGATATTA
ATCAGGCATGGAGAGTCGCTATGGAACGAGAAGAACCTCTTCACAGGCTGTGTTGATGTTCCATTAACCGAGAAAGGCGT
TGCTGAAGCTATCCAAGCCGGGAAGAGGATTAGCACCATCCCCGTTGATCTGATCTTCACTTCCTCCCTCATCCGTGCTC
AGATGACTGCTATGCTCGCCATGACTCAGCACCGCTGCAAGAAGGTTCCCATCATCTTGCATGATGAGAGCGAGAAGGCG
CAGACTTGGAGCCATGTCTTCAGCGAAGAGACAAGGAAGCAGTCTATCCCTGTTGTAGCTGCTTGGCAGCTGAATGAGAG
AATGTATGGAGAGTTACAGGGTTTAAATAAGGAGGAAACAGCTGAGAGATACGGAACGCAGCAAGTTCATGAGTGGCGTA
GGAGTTATCACATCCCTCCTCCTAAAGGAGAGAGCTTGGAGATGTGTGCTGAGAGAGCTGTGGCTTACTTTGAAGACAAT
ATTCAACCAGAGCTTGCGTTAGGGAACAATGTGTTGATCGCTGCTCATGGGAACTCGTTGAGGTCTATCATTATGTATCT
TGACAAATTAACTTCTCAGGAGGTTACGAGTTTAGAGCTGTCTACTGGTTTACCGTTGCTTTACATCTTCAAAGACAGGA
AGTTCATGAGACGAGGAAGCCCCGTTGGTCCTACAGAAGCTGGTGTCTATGCTTATACTAAGAGATTGGCACAATACAGA
CAGAAGCTTGATGAGAGCCTTAACTAA