Details for Chinese cabbage Locus Brara.G03551

Position : A07 ( 5`- 26489517 .. 26490641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03551

Protein [Map View]
MAKLVMLMVLCILPAIAMAAPRPRIGKNTLVVQGITYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTDVATSN
RHGKYMFVVHEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDVFCSELIKKYQV
DEDEI*

DNA
ATGGCGAAACTAGTGATGCTGATGGTCCTCTGTATCTTGCCGGCGATTGCCATGGCGGCGCCTAGGCCACGTATCGGTAA
GAACACGTTGGTGGTTCAAGGTATCACTTACTGTGACACTTGCAAGTTCGGCTTCGAGACTGCTGAGTCCTCCTACACCG
TCCCCGGTGCGACGGTGAAGCTTGTGTGCAGAGACAGGAAGACGATGAAAGAGTTATACACAGACGTAGCTACTTCAAAC
AGGCATGGGAAGTACATGTTCGTTGTCCACGAGGACCACAAGGACGAGATGTGCGATGTTATGCTTGTCAAAAGCTCAGA
CAAGGGTTGTTCTAAAATCTCTAAGGGGCGTGAACAGTCGCGTGTGATCTTGAACCATTACAACGGCATTGCGTCGCAGA
TTAGGCATGCTAACAACATGGGGTTCGAGAAAGATGTTTCTGATGTGTTTTGCTCTGAGCTCATCAAGAAGTATCAGGTT
GATGAAGATGAGATTTAA