Details for Chinese cabbage Locus Brara.G03549

Position : A07 ( 5`- 26478732 .. 26482208 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03549

Protein [Map View]
MFISVVVFVGRLSESVFPPSMELLLSFRSAGVHLLRRAAPIITRTNRLTKPTSKNLTFLLFSSAAAKTPLLKPQATSEKG
SFVFKGDERMRGPLSSNDAFENQFQSSSTIAAIVTPVGGPPGAVGIVRLSGDKAVEVARRVFRSAKRRRRKVEESDCSED
SWRPRSHFVEYGVVVDSKGSVVDEVLAVPMLAPRSYTREDVIELQCHGSEVCLRRVLRACVDAGARLAEPGEFTLRAFLN
GRLDLTQAENVEKLISAKSSAAADAALEGIQGGFSSLVKSLRAQCIELLTEIEARLDFDDEMPPLDTNLVISKINKMSED
VESALDTANYDKLLQTGLQVAIIGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVVEASVTLRGVPVTLLDTAGIRETND
IVEKIGVERSETAAKLADVIIMAVNAVEGWTEEDTELLHKIQSDKPMILVMNKIDCATPDTCELLDDKKEEAFHRSVFTS
AVTGQGIEEIEEAILEILGLDRVPSGGHQWTVNQRQCEQLVRTKEALERLREAIKDELPIDFWTIELREAALALAQISGQ
DVSEEVLSSIFAKFCIGK*

DNA
ATGTTTATCTCTGTTGTTGTATTCGTTGGCCGCCTATCCGAAAGCGTCTTTCCGCCGTCAATGGAGCTTCTCCTCTCCTT
TCGCTCCGCCGGAGTTCACCTCCTCCGCCGCGCCGCTCCGATCATAACGCGAACCAACAGACTAACCAAACCCACCTCTA
AAAATCTAACCTTTCTCTTATTCTCCTCAGCTGCTGCTAAAACCCCTCTTCTTAAACCCCAAGCCACGTCAGAGAAGGGC
TCTTTTGTTTTCAAGGGGGACGAGCGTATGAGAGGTCCTCTGAGCAGCAACGACGCGTTCGAGAACCAGTTTCAGAGCTC
GAGTACCATTGCAGCTATCGTGACGCCGGTCGGTGGGCCACCTGGCGCGGTTGGGATCGTGCGGTTGTCGGGGGATAAGG
CTGTGGAAGTTGCTCGACGAGTGTTTCGTTCTGCTAAGAGGAGGAGGAGGAAGGTGGAGGAGAGTGATTGTTCTGAAGAT
TCGTGGAGGCCAAGGAGTCATTTCGTGGAGTATGGAGTTGTTGTTGATTCAAAGGGCAGTGTTGTTGACGAGGTTTTAGC
TGTGCCTATGTTGGCTCCTCGGTCATACACAAGGGAAGATGTAATTGAGCTTCAGTGTCACGGTAGCGAAGTTTGTCTGC
GGCGTGTCTTGAGAGCATGTGTTGATGCTGGAGCAAGATTAGCAGAACCAGGAGAGTTTACACTTCGTGCGTTTCTAAAT
GGGCGTTTAGACCTTACACAAGCTGAAAACGTTGAGAAACTTATCTCAGCCAAGTCCTCTGCTGCTGCGGATGCTGCTTT
AGAAGGGATTCAGGGAGGTTTTTCGTCTTTGGTCAAATCACTAAGAGCGCAATGCATTGAGCTCCTCACTGAGATAGAAG
CTCGTTTGGATTTCGATGACGAGATGCCTCCATTGGATACAAACTTGGTTATAAGCAAAATAAACAAAATGTCTGAAGAT
GTAGAGAGTGCGTTAGATACAGCAAACTATGACAAGCTTCTTCAAACCGGGTTGCAGGTAGCTATTATTGGGCGTCCGAA
CGTGGGGAAATCGAGTCTTTTGAATGCTTGGAGCAAAAGTGAGAGAGCCATTGTTACGGAAGTTGCTGGAACTACACGTG
ACGTAGTGGAAGCTAGTGTTACACTCCGTGGCGTGCCTGTCACTCTTCTTGACACTGCTGGTATCAGAGAAACCAACGAC
ATTGTCGAAAAAATAGGAGTTGAGAGATCAGAAACAGCAGCTAAACTTGCTGATGTAATAATCATGGCGGTGAATGCTGT
TGAAGGCTGGACTGAAGAAGACACTGAGCTTCTACATAAGATACAATCTGACAAGCCTATGATTCTGGTGATGAACAAAA
TCGACTGTGCTACTCCTGATACCTGTGAACTACTAGATGATAAGAAGGAAGAAGCTTTCCATAGATCTGTATTTACATCT
GCTGTTACTGGTCAAGGAATTGAAGAGATTGAAGAAGCAATACTGGAGATTCTTGGTCTTGATCGTGTCCCTAGTGGAGG
ACATCAATGGACAGTGAATCAGAGACAATGTGAGCAACTAGTGCGGACGAAAGAGGCGTTAGAGAGGCTGAGAGAAGCAA
TCAAAGATGAGCTTCCGATTGATTTCTGGACTATTGAGCTTAGAGAAGCTGCTTTGGCTCTTGCTCAGATCAGTGGCCAA
GATGTCTCTGAAGAGGTCTTATCCTCCATTTTTGCCAAGTTCTGTATTGGTAAATAA