Details for Chinese cabbage Locus Brara.G03547

Position : A07 ( 5`- 26462601 .. 26467043 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03547

Protein [Map View]
MSIEMQSHQAEAAPAEEPLSQWLINMPEPPTIWQEFVGYIRTNVLSKKRNKMKKKSSNPVSSYLKSVFPILIWGRQYKLN
MFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPPLIYSMMGSSRELAIGPVAVVSLLLSSMVSDLQDPVTDP
IAYRKIVFTATFFAGAFQAIFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVLSSVFHSL
HHPWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNAETRGVKIVKNIKPGFNRPSVNQLE
FNGPHLGQVAKIGIICAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMGFSNIAGSLTSCYVATGSFSRTAVNFSAGCET
VVSNIVMAITVMVSLEVLTRFLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLVAAFLGVLFASVEIGLLLA
VGISFTRIILSSIRPTVEALGRLSKTDIFGDINQYPMATKTQGLLTLRISSPLLCFANANFIRDRILNSIQKVEEGEDDE
QEVKRAKVLQVVILDMSCVMGLDTSGVVALEELHQELASNDTQLVIASPRWRVFHKLKRAKLEEKVKKENIFMTVGEAVD
FYVRARTTSHDMC*

DNA
ATGAGCATAGAGATGCAGAGCCACCAGGCGGAAGCCGCCCCCGCAGAAGAGCCGTTGTCCCAGTGGCTGATAAATATGCC
GGAGCCACCAACCATATGGCAAGAGTTTGTTGGGTACATAAGAACAAATGTGTTGTCCAAGAAGAGGAACAAGATGAAGA
AGAAATCATCAAACCCGGTTTCCTCTTATCTTAAATCGGTTTTCCCTATACTTATATGGGGAAGACAATACAAACTCAAC
ATGTTCAAGAAAGATTTGATGGCTGGTCTTACTCTCGCTAGTCTTTGCATTCCTCAGAGTATAGGATATGCTAATTTGGC
TGGACTCGATCCAGAGTACGGTCTATATACAAGTGTGGTACCACCTCTAATATATTCCATGATGGGAAGTTCGAGAGAGT
TAGCCATTGGTCCTGTGGCTGTAGTTTCGCTTCTGCTTTCGTCCATGGTCAGTGACCTTCAAGATCCTGTCACCGACCCA
ATTGCTTACCGAAAAATTGTCTTCACGGCCACGTTTTTTGCTGGCGCGTTTCAAGCCATCTTTGGACTCTTCAGGTTAGG
GTTTTTGGTGGATTTTCTGTCACATGCTGCTCTTGTTGGGTTCATGGCTGGTGCTGCCATTGTCATTGGTTTACAACAAC
TGAAAGGTTTATTTGGTTTGTCTCATTTTACCAACAAAACCGATGTGGTTTCGGTTTTATCTTCGGTTTTCCACTCACTT
CATCATCCGTGGCAACCTTTGAACTTTGTCATTGGTAGCTCATTCCTTATCTTCATCCTCCTAGCGAGATTTCTCGGAAA
AAGAAACAAAAAATTGTTCTGGATTCCAGCGATGGCACCGCTAATATCAGTGATATTAGCAACCCTAATCGTGTATTTAA
CCAATGCTGAAACACGAGGGGTTAAGATTGTTAAAAACATTAAACCAGGGTTTAACCGACCTTCTGTTAACCAATTGGAA
TTTAACGGTCCACATCTCGGTCAAGTCGCCAAAATTGGTATCATTTGTGCAATCATCGCTCTCACGGAGGCGATTGCAGT
AGGGAGATCTTTTGCAACGATCAAAGGATATCGTCTAGATGGTAACAAAGAGATGATGGCAATGGGATTTAGCAACATCG
CTGGCTCTTTAACTTCTTGCTATGTAGCTACCGGATCATTTTCAAGAACGGCGGTGAATTTTAGTGCTGGCTGCGAGACG
GTGGTATCAAACATTGTAATGGCGATAACAGTGATGGTTTCGCTTGAAGTTTTGACAAGGTTTCTCTATTTTACACCGAC
CGCAATACTGGCCTCCATCATTCTCTCGGCGCTTCCTGGCCTTATCGATATTTCTGGCGCTTTGCACATTTGGAAGCTTG
ATAAGCTTGATTTTCTCGTCCTTGTGGCCGCCTTCTTAGGTGTCCTGTTTGCCTCCGTAGAGATCGGTCTTCTACTCGCC
GTGGGGATATCGTTTACGAGAATAATTTTGAGTTCGATACGACCAACAGTTGAGGCTTTAGGCAGATTGTCAAAAACCGA
TATCTTCGGTGACATAAATCAGTACCCAATGGCTACTAAGACCCAAGGACTATTGACTCTTCGAATCAGCTCTCCGTTGT
TATGCTTTGCAAATGCTAATTTTATTAGAGACCGAATATTGAATTCAATTCAAAAGGTAGAAGAAGGGGAAGATGATGAA
CAAGAAGTTAAAAGGGCAAAAGTTCTTCAAGTAGTAATTCTCGACATGTCTTGCGTGATGGGCCTAGATACATCAGGAGT
AGTCGCACTTGAAGAATTACATCAAGAGTTGGCTTCTAATGACACCCAGTTAGTGATCGCTAGTCCAAGATGGAGAGTAT
TTCACAAACTGAAGCGAGCGAAACTGGAGGAGAAAGTGAAAAAAGAAAATATATTTATGACAGTAGGAGAAGCCGTAGAT
TTTTATGTAAGAGCAAGAACTACGTCGCACGATATGTGTTGA