Details for Chinese cabbage Locus Brara.G03544

Position : A07 ( 5`- 26455414 .. 26457381 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03544

Protein [Map View]
IQQVSSDAFGSLFPQRFHRFSDDNLPVITTNTTATSLNRQQHCLCAHTLSTREPLLSNRNHNYYDLNQFLAVNTEHSSHI
GPSNLIPNGLHNYMPHQTYVPITSAFNINGQQLPPSVLAIRRNEAHNLRTVNNSARHHVNMQRRLHQSSSSFRVSSLYTL
LRRRPSANSSIPPQNEVIGSRRRTYESRFQFGEPSSSTRRRRATPADGSVGSTAINPTEERRVNGLYDPEYQRQGLCIDP
HLRNFLNQ*

DNA
ATACAACAAGTAAGTTCTGATGCATTTGGTTCACTGTTTCCTCAACGCTTCCATCGTTTTTCAGATGATAACCTTCCAGT
TATCACCACAAACACAACAGCAACTTCTCTAAACAGACAACAACATTGTCTTTGTGCTCATACTCTTTCAACTAGAGAGC
CTCTGTTAAGCAACCGAAATCATAATTATTATGATTTGAATCAATTTTTGGCGGTGAATACAGAGCATTCAAGTCACATA
GGCCCGAGCAATCTCATTCCAAATGGGTTACATAATTATATGCCTCATCAGACGTATGTCCCAATCACTTCGGCTTTTAA
CATAAATGGACAGCAACTGCCCCCATCGGTTTTAGCCATTCGGCGTAATGAAGCTCACAATCTAAGGACGGTTAACAATT
CAGCTAGGCATCATGTCAATATGCAAAGAAGGTTGCATCAGTCCTCATCAAGTTTTCGGGTTTCCAGCTTATACACTCTG
CTGCGTAGACGTCCAAGCGCAAACTCAAGCATACCTCCACAAAATGAAGTTATAGGATCTCGGCGAAGAACTTATGAAAG
TCGGTTTCAATTTGGGGAACCATCATCTTCTACTCGACGCAGGAGGGCTACACCAGCAGATGGAAGTGTTGGTTCAACTG
CAATCAATCCTACCGAAGAAAGGAGAGTAAATGGACTGTACGATCCAGAATACCAAAGACAAGGTCTATGTATTGACCCT
CACTTGAGAAATTTTCTCAATCAATAA