Details for Chinese cabbage Locus Brara.G03535

Position : A07 ( 5`- 26407459 .. 26409467 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03535

Protein [Map View]
MALQNIGASNRNDAFYRYKMPKMVTKTEGKGNGIKTNIVNNVDIAKALARPASYTTKYFGCELGAQSKFDEKTGTSLVNG
AHSTSKLASLLEAFIKRYVQCYGCGNPETEIVITKSQMVNLKCAACGFVSECDMRDKLTTFILKNPPEAKKVGKDKKAMR
RAEKERVKEGEAADEAMKRLKKKDGCSKVSKKDASDEEVSPKHDGSADDDDDDDDGIQWQTDTSREAAEKRMKELSAATA
EMVMISLDEEEEKKSLGHEMKEYLKKGLPISELKAFISSLSEPPQEVMDALFSALFDGVGKGFLKEAMKKKDYLAAATQE
EGSQMHLLNSFGSFCGKSGNGEAVKEAAQVLKALYDEDVVEEEFVLEWYQKGLAGADKSSPVWKSVKPFVVWLQSAESES
EGEA*

DNA
ATGGCGCTCCAGAACATTGGTGCTTCCAACCGCAACGACGCCTTTTACCGTTACAAGATGCCTAAGATGGTTACCAAAAC
CGAAGGCAAAGGTAACGGCATCAAGACCAACATTGTCAACAACGTCGACATCGCCAAGGCTTTAGCGAGGCCTGCTTCTT
ATACTACAAAGTACTTTGGCTGCGAGCTTGGAGCTCAGTCCAAGTTTGATGAGAAGACTGGGACTTCTCTTGTGAACGGA
GCTCATAGCACTTCGAAGCTTGCGTCTCTGTTAGAGGCTTTTATTAAGAGGTATGTTCAGTGTTATGGGTGTGGGAACCC
TGAGACTGAGATTGTTATTACCAAGAGTCAGATGGTGAATCTGAAGTGTGCTGCTTGTGGGTTTGTCTCTGAGTGTGATA
TGAGGGATAAGTTGACGACTTTTATTCTGAAGAATCCGCCGGAGGCGAAGAAGGTGGGGAAGGATAAGAAGGCTATGAGG
AGAGCTGAGAAGGAGAGGGTGAAGGAAGGTGAGGCTGCTGATGAGGCGATGAAGAGGCTTAAGAAGAAGGATGGTTGTTC
TAAGGTGTCTAAGAAGGATGCTTCTGATGAGGAGGTTAGTCCGAAGCATGATGGGAGTGCAGATGATGATGATGATGACG
ACGATGGGATCCAATGGCAGACTGATACTTCTAGAGAAGCTGCTGAGAAGAGGATGAAGGAGCTGAGTGCTGCTACTGCT
GAGATGGTGATGATCTCTTTAGACGAAGAGGAGGAGAAGAAGAGTCTGGGGCATGAGATGAAAGAGTATCTGAAGAAGGG
TTTGCCGATAAGCGAGCTCAAAGCTTTCATCTCCTCTCTCTCTGAGCCTCCTCAGGAGGTCATGGACGCGCTTTTCAGCG
CTCTCTTTGACGGCGTGGGGAAAGGTTTTCTCAAGGAAGCGATGAAGAAGAAGGATTACTTGGCGGCTGCGACGCAGGAG
GAAGGTTCGCAGATGCATCTGCTCAACTCTTTTGGTTCCTTCTGCGGGAAGAGTGGAAACGGAGAGGCGGTTAAAGAGGC
GGCTCAGGTTCTCAAGGCGCTGTACGACGAAGACGTTGTTGAGGAAGAGTTTGTGTTGGAGTGGTACCAAAAGGGTTTGG
CAGGAGCTGACAAGAGCTCGCCTGTTTGGAAGAGTGTTAAGCCTTTTGTGGTGTGGCTGCAGAGCGCTGAGTCTGAGTCC
GAAGGGGAGGCTTGA