Details for Chinese cabbage Locus Brara.G03533

Position : A07 ( 5`- 26396411 .. 26403346 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03533

Protein [Map View]
MSVDQCQRREKMMGRGVDGGCGAEERPCRPSRRDSKGFEEERSSQGIDLLAQASKHLSERSPYDVNEDGSSVGVSVGTLP
IALANLLNQKDDKKRHKKSHHGGETKKKKSNRQGEKLKAGSIWVERQEYFRRLELPDLETLSDLASLRSLSSRSCFSVPS
VEYESLNIQQRETDASEKSEDVVGKEKEEINEEAVQPMSVDNVGDEVSSGADYSGSLEWVLGCRNRILLASERPSKKRRR
IGSDAGLEKLVVAAPCRGDALLCDFCCTGDAKEHHNQLIVCTSCKATVHRKCYGVVEDADDTWLCSWCEMENGGSDSERP
CLLCPKKGGILKPVVSKTENGGPPEFAHLFCSLWMPEVYIEDLNKMEPILNLPGIKETRRKLLCNLCKVKSGACIRCCNE
CSLCGGTTGAFRKATNGQWVHAFCAEWSLESTFRRGQTNPVQGMESLAKSTSTCCVCQRIYGACFKCSYGNCQATFHPTC
ARSAGFHMIGGGKLPHKAYCEKHSLEQKAKAESQKHGEDGLKSLKHYRVELERLRLLCERIVKREKLKRELAISSHEILA
ARRDHAARSLPVRNPFSPPEVSSDSATTSIKGHPDSNVSGSEAIQRSDDITIDSTASVKQRRGKGPIAMDSDQKTDDSAT
SKGRSKILSGKTVPRKHCIVSPSVSEDGDEEGSKPKKHVETFAKEIVMTSDEASFKNRRLPKGYFYVPVDCLQEDKPSND
KAEEDSSDK*

DNA
ATGAGCGTTGACCAATGCCAGCGGCGGGAGAAGATGATGGGTAGGGGAGTGGACGGAGGCTGCGGTGCTGAGGAGAGGCC
TTGTAGACCATCTCGCAGGGATAGCAAAGGATTCGAGGAGGAGAGGAGTTCGCAGGGAATCGATTTGTTAGCTCAGGCGA
GCAAGCATCTCTCCGAGAGGTCTCCGTATGATGTTAACGAGGATGGTTCGAGTGTTGGTGTGAGTGTGGGGACTTTGCCT
ATTGCGTTGGCTAATTTGCTGAACCAGAAGGATGATAAGAAGCGGCATAAGAAGTCTCACCATGGGGGTGAAACGAAGAA
GAAGAAGTCTAATAGGCAAGGGGAGAAGCTGAAGGCTGGGAGTATTTGGGTTGAGCGTCAGGAGTATTTTAGGCGGTTAG
AGTTGCCTGATTTAGAAACTTTGTCGGATTTAGCTTCTCTAAGGTCTTTATCTTCTCGAAGCTGCTTTTCAGTTCCATCT
GTGGAGTACGAATCACTTAATATACAGCAGAGGGAAACTGATGCGAGTGAAAAGAGTGAGGATGTTGTTGGTAAAGAGAA
AGAAGAGATAAACGAAGAAGCTGTGCAGCCAATGAGTGTGGACAATGTGGGGGATGAGGTCTCATCAGGGGCAGACTATT
CTGGTAGTTTAGAATGGGTTTTAGGTTGCAGAAATAGGATTTTGTTGGCATCAGAAAGGCCCTCCAAGAAGCGGAGGCGT
ATTGGTAGTGATGCAGGTTTGGAGAAGTTAGTGGTTGCCGCTCCTTGCAGAGGGGATGCATTGTTATGTGATTTTTGCTG
CACTGGTGATGCTAAGGAACATCATAACCAGTTGATTGTTTGCACTTCCTGCAAAGCTACAGTTCATAGAAAATGCTATG
GTGTGGTTGAAGATGCGGATGATACTTGGTTGTGCTCCTGGTGTGAGATGGAGAATGGTGGTAGTGACTCTGAAAGACCA
TGCTTGCTCTGTCCGAAAAAGGGTGGCATTCTGAAACCTGTTGTCTCAAAAACTGAGAACGGTGGGCCGCCGGAGTTCGC
TCATCTGTTTTGTTCTTTGTGGATGCCTGAGGTGTACATAGAAGACTTGAATAAAATGGAGCCGATCTTGAATTTGCCTG
GAATAAAAGAAACTCGAAGAAAGTTATTGTGTAACTTGTGCAAGGTGAAATCTGGTGCTTGCATTCGGTGTTGTAATGAG
TGCAGTTTATGTGGAGGCACAACTGGGGCTTTTAGGAAAGCCACAAACGGCCAGTGGGTGCATGCATTTTGTGCGGAGTG
GTCTTTGGAATCAACCTTCAGAAGGGGGCAAACAAATCCTGTGCAGGGAATGGAGTCACTGGCCAAGAGCACCAGTACTT
GTTGTGTATGCCAACGGATATATGGTGCATGCTTTAAGTGTAGTTATGGCAACTGCCAGGCGACATTCCACCCAACCTGT
GCCAGAAGTGCTGGTTTTCATATGATTGGTGGTGGGAAGCTTCCGCATAAGGCTTACTGTGAGAAACACAGCTTGGAACA
GAAGGCAAAGGCCGAATCTCAGAAACACGGGGAAGATGGGCTGAAAAGTCTCAAGCATTATAGGGTTGAACTAGAGAGGT
TACGCCTTCTGTGCGAGCGGATAGTCAAGAGGGAGAAGCTAAAACGAGAGTTGGCTATTTCCTCACATGAGATACTTGCT
GCTAGAAGGGACCACGCTGCACGTTCATTACCTGTCCGTAATCCATTTTCTCCTCCAGAAGTTTCTTCCGACTCAGCTAC
GACATCAATAAAAGGGCATCCGGATAGTAATGTATCTGGCAGTGAAGCGATACAGAGGTCAGATGATATCACCATTGACA
GCACAGCCTCTGTTAAGCAGCGCCGAGGCAAAGGTCCTATTGCAATGGATAGTGATCAGAAAACCGACGATAGTGCTACT
TCCAAGGGTCGGAGCAAAATACTTTCTGGGAAAACGGTTCCACGCAAACATTGTATAGTCTCGCCAAGTGTTTCAGAGGA
TGGAGATGAAGAAGGATCAAAGCCCAAGAAGCATGTAGAAACGTTTGCGAAGGAGATTGTGATGACATCGGACGAAGCTT
CTTTCAAGAATCGGCGGCTGCCAAAGGGCTACTTTTACGTTCCGGTTGATTGCTTGCAAGAAGACAAGCCAAGCAACGAC
AAGGCGGAGGAGGACTCGTCTGACAAGTGA