Details for Chinese cabbage Locus Brara.G03532

Position : A07 ( 5`- 26391361 .. 26392152 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03532

Protein [Map View]
MGKIKKVDRKARIAAAPYPPPPSCCKKEWAGSTCPVCLESPHNAVLLLCSSYHKGCRPYMCATSSRFANCLDQYKKSYEN
EDSEQPQLLCPLCRGQVKGWTVVEDTRVHFNSKRRTCMQDSCSFVGNFKKLKKHMKEKHPDACPRAIDPALESKWKRLER
ERDRRDVISTIMSSIPGAVVLRDYVIEPRNGGVYDEDDDEDDYSSDDDMGNNGVLNLDSWQGQGHHIRFIDMDASDFASS
SRSHASPSSLLLPRNQRGGNRDR*

DNA
ATGGGGAAAATCAAGAAAGTGGATCGTAAGGCTCGCATTGCTGCTGCTCCTTACCCACCACCACCGTCGTGTTGCAAGAA
AGAATGGGCAGGATCAACGTGCCCAGTATGTTTGGAGTCTCCACACAACGCTGTTCTTCTCTTGTGCTCCTCCTATCACA
AAGGATGCCGTCCATACATGTGCGCGACGAGCAGCCGTTTCGCCAATTGTCTCGACCAGTACAAGAAGTCGTACGAAAAC
GAAGACTCAGAGCAGCCTCAGCTTCTGTGTCCACTATGCAGAGGTCAGGTGAAAGGCTGGACTGTTGTGGAAGACACCCG
GGTGCATTTCAACTCCAAGAGGAGGACTTGTATGCAGGACAGCTGCTCCTTTGTGGGGAACTTCAAAAAACTCAAGAAAC
ACATGAAGGAGAAGCACCCAGACGCTTGCCCCAGGGCCATTGATCCAGCTCTTGAAAGTAAATGGAAGAGGCTTGAGAGG
GAGAGAGACAGAAGAGATGTGATAAGCACGATAATGTCGTCGATCCCAGGTGCTGTTGTGTTGAGAGATTATGTCATTGA
GCCTCGTAACGGCGGTGTTTATGATGAAGATGATGACGAAGATGATTACAGCTCAGATGATGATATGGGCAACAACGGGG
TATTGAATCTAGATTCATGGCAAGGACAAGGCCATCACATTCGGTTTATAGATATGGATGCAAGCGACTTCGCATCATCT
TCTCGATCTCATGCTTCTCCAAGCAGTTTGCTCTTACCAAGGAACCAGAGAGGCGGCAATAGAGATCGGTAA