Details for Chinese cabbage Locus Brara.G03531

Position : A07 ( 5`- 26389946 .. 26390920 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03531

Protein [Map View]
MGDDNPRIMHGVIITVYVDRRTTLVRSFRVRRRNECTWNREIGRARGYDRRANLLAYIRQMRAESLARDSKDEDDVVENN
IKPERKKKKRRWLRKMMSKLRLPFLRPFRRKNRTWKYRHFAPDEEEEGEANSKPYRSDLWKKLKHVVGGLSRGCIRSRRN
A*

DNA
ATGGGAGATGATAATCCAAGGATCATGCACGGTGTGATCATCACCGTCTACGTTGATCGTCGAACGACCCTCGTCCGATC
GTTTCGAGTTAGACGGAGAAATGAATGTACGTGGAATCGTGAGATTGGAAGGGCGCGTGGGTATGATCGGAGAGCGAATT
TGCTAGCGTATATTCGACAGATGAGAGCTGAAAGTCTTGCCAGAGATTCGAAAGATGAAGACGACGTCGTCGAGAATAAC
ATCAAACCTGAACGGAAGAAGAAGAAACGAAGGTGGCTAAGAAAAATGATGAGTAAGCTCCGGTTACCGTTTCTCCGGCC
GTTTCGTCGAAAAAATAGGACGTGGAAGTACCGACATTTTGCACCAGATGAAGAAGAAGAGGGAGAAGCAAACAGTAAAC
CTTACCGTTCAGATCTTTGGAAAAAGCTTAAACATGTAGTTGGAGGGTTATCACGCGGCTGCATACGAAGTAGAAGAAAC
GCGTGA