Details for Chinese cabbage Locus Brara.G03528

Position : A07 ( 5`- 26368764 .. 26371900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03528

Protein [Map View]
MEREANLPDKPPKSRILPTFKQESPSSSSSSSSSPELLRHIQAAFKRHRPLSKMQKSSIGPRRMVAPQRQPSRSSSSTAE
GQQRPQDVVSLSHQSLAANTLTHDTRTLASSSVTRESTENPSITPPSVSGATDNMFGENLNPSDRLIDLRKPAPVMKMNE
NENVNRKVQSLADTTTLTSHDMEWDTTNQAEASNVGASTSTRSKHHNLQSVDSETSLKSEYKASSSSLAKMGEFRSFLNQ
PASQCSAMGSSCATTTSIRSSSAPMFNATTQVSRCYVEADANAVSSQVNLSSSRPSSTKDVPLSEMPASAIDPEVRVKEK
QQQCTTEIEAPAVSSSHDVTAKPTLPDELLTSVSSQLQKPDKQEKVASSKVTSAPRKRNYDPDLFFKVNGKLYQRLGKIG
SGGSSEVHKVISSDCTIYALKKIKLKGRDYATAYGFCQEIGYLKKLKGKTNIIQLIDYEVTDKCLLQEVLNGTMSNKDAR
VKDDGFIYMVLEYGEIDLAHMLSQKWKEIEGSDRTIDENWLRFYWQQILQAVNTIHEERIVHSDLKPANFLLVRGFLKLI
DFGIAKAINCDTTNIQRDSQVGTLSYMSPEAFMCNESDENGNTIKCGRPSDIWSLGCILYQMVYGRTPFADYKTFWAKFK
VITDPNHEITYNQLSNPWLVDLMKNCLAWDRNQRWRIPELLQHPFLAPPIPPEPRVSSSSIQLISHIAASFGSDDGVSEL
CAQLQDRLRVLEGE*

DNA
ATGGAAAGGGAGGCTAATCTTCCGGATAAACCTCCGAAGAGTCGGATTCTCCCCACCTTCAAGCAGGAATCACCATCATC
GTCTTCTTCCTCCTCCTCCTCCCCCGAACTTCTACGCCATATTCAAGCCGCTTTCAAGCGTCATCGTCCTCTCAGTAAAA
TGCAGAAGTCCTCTATCGGGCCTCGGCGAATGGTTGCTCCGCAACGACAACCTTCAAGGAGTAGTTCTTCTACAGCTGAA
GGACAGCAGAGACCTCAAGATGTTGTTTCCTTGAGTCATCAGAGTCTTGCTGCCAATACGTTGACTCACGATACAAGAAC
CTTAGCCTCCTCTTCTGTTACTAGAGAATCTACAGAGAATCCGTCCATTACTCCACCTTCAGTTTCAGGAGCTACTGATA
ATATGTTTGGCGAGAATCTCAACCCTTCAGACAGGCTGATTGATTTGCGGAAACCTGCTCCGGTAATGAAAATGAATGAG
AATGAAAATGTCAACAGAAAGGTTCAGTCTCTCGCTGACACCACCACCCTCACTTCTCATGATATGGAATGGGATACAAC
AAACCAGGCTGAAGCATCAAACGTTGGTGCTTCTACTAGTACTAGATCAAAGCATCATAATCTCCAATCCGTTGATTCCG
AGACCAGTTTGAAATCTGAGTACAAGGCTTCTTCATCTTCCTTGGCAAAGATGGGAGAGTTTCGCAGCTTCTTGAACCAA
CCTGCTTCTCAGTGTTCTGCAATGGGGTCATCATGCGCCACAACTACGTCAATTCGTTCGTCTTCAGCTCCTATGTTTAA
CGCGACTACCCAAGTCTCTCGTTGTTATGTTGAGGCTGATGCAAATGCTGTTTCAAGTCAAGTGAACTTGTCTTCTTCTC
GTCCTTCTTCCACTAAAGATGTCCCTTTGTCTGAGATGCCAGCCTCAGCTATTGATCCAGAAGTAAGAGTCAAAGAGAAG
CAGCAACAGTGCACTACAGAGATTGAAGCTCCAGCAGTATCTTCCAGTCATGACGTAACAGCTAAGCCCACTCTACCAGA
TGAGTTGCTCACCAGTGTTAGCTCACAGCTGCAGAAACCAGATAAGCAAGAAAAGGTTGCAAGTAGCAAAGTGACATCAG
CTCCTCGGAAAAGAAACTATGATCCAGACTTGTTCTTTAAAGTCAATGGTAAACTCTACCAGAGGCTTGGCAAGATAGGA
AGTGGAGGAAGCAGCGAGGTCCACAAGGTTATTTCATCAGACTGTACCATATACGCGCTCAAGAAAATCAAGCTCAAGGG
CCGTGACTATGCTACAGCATATGGATTTTGCCAGGAGATTGGGTATTTAAAGAAGCTGAAAGGGAAAACCAACATCATTC
AGCTAATAGACTACGAGGTTACAGATAAGTGTTTACTCCAGGAGGTTTTGAATGGGACAATGAGTAACAAAGATGCAAGA
GTTAAGGACGATGGGTTTATATACATGGTGCTAGAATATGGAGAAATCGATCTGGCTCACATGTTATCTCAAAAATGGAA
GGAAATCGAAGGTTCTGACCGGACAATTGATGAAAATTGGCTTCGGTTCTACTGGCAGCAAATACTTCAAGCTGTGAACA
CCATACATGAAGAACGCATTGTGCACTCTGATCTGAAACCGGCAAACTTCCTTCTTGTCAGAGGCTTCTTAAAGCTTATC
GACTTTGGTATCGCTAAGGCCATTAACTGCGACACTACAAATATCCAACGAGATTCGCAGGTGGGGACGTTGAGTTACAT
GTCACCAGAAGCATTCATGTGCAACGAGAGCGATGAAAACGGAAACACCATAAAATGCGGAAGGCCATCAGATATATGGT
CGCTTGGTTGCATACTATACCAAATGGTGTACGGAAGAACACCTTTTGCAGATTACAAAACCTTCTGGGCGAAGTTCAAA
GTCATAACCGATCCAAACCATGAGATCACTTACAATCAGCTCTCTAACCCGTGGCTCGTCGACCTGATGAAGAACTGTCT
AGCTTGGGACCGTAACCAGAGATGGAGAATCCCTGAGCTTCTCCAACATCCTTTCCTTGCCCCTCCCATCCCACCCGAGC
CTCGAGTCAGCAGCAGCAGCATTCAACTTATTAGTCACATAGCTGCATCTTTTGGTAGTGATGACGGGGTTTCAGAGCTT
TGTGCTCAACTCCAGGACCGGTTACGTGTTCTCGAAGGAGAATGA