Details for Chinese cabbage Locus Brara.G03527

Position : A07 ( 5`- 26366033 .. 26368120 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03527

Protein [Map View]
MGFRLNLPLRILLLHLTLLSVTKWSESARVFTIVNSCDQTIWPAITPGENFSGGGFKLKPGHSIVFKAPVGWSGRIWGRT
GCKFNKTGTGSCKTGSCGSNLKCTTAGKQPVSLAEFTLASLDFYDVSLVDGFNLPMTLTPVNGTGNCTVVRCVADLRPRC
PAELAVKSKGKVISCRSACDVFDTDEYCCRGVYGNPSTCRPTHYSKIFKRACPTAYSYAYDDPTSIFTCSGSDYVISFCS
YRKKPVGT*

DNA
ATGGGATTTCGTCTCAATTTGCCACTAAGGATCTTGTTACTACATCTCACACTATTATCAGTGACAAAATGGTCCGAATC
AGCTAGAGTATTCACGATCGTGAACTCATGTGACCAAACAATATGGCCGGCGATAACTCCCGGAGAAAACTTCAGCGGCG
GAGGATTCAAGCTCAAACCTGGCCACTCCATCGTCTTCAAAGCACCAGTAGGCTGGTCAGGCCGAATTTGGGGACGAACC
GGCTGCAAATTCAATAAAACCGGAACCGGAAGCTGTAAAACCGGTTCATGCGGCTCAAACCTAAAATGCACAACTGCTGG
AAAACAACCAGTTTCACTAGCCGAGTTCACGCTAGCCTCATTAGATTTCTACGACGTGAGCCTCGTCGACGGATTCAATC
TCCCGATGACATTGACTCCGGTGAACGGAACAGGAAACTGCACCGTGGTCCGCTGCGTCGCCGATTTGAGGCCAAGGTGT
CCGGCGGAGCTAGCTGTGAAATCTAAGGGGAAAGTTATATCGTGTAGGAGTGCTTGTGATGTGTTCGATACAGATGAGTA
TTGTTGCAGGGGAGTTTATGGGAACCCTTCAACGTGTCGACCAACTCATTACTCGAAAATATTCAAGAGAGCTTGTCCTA
CTGCTTACAGCTATGCTTATGATGATCCGACCAGTATCTTCACTTGTTCCGGTTCAGATTACGTCATCTCTTTCTGTTCC
TACAGGAAGAAGCCGGTGGGAACGTAA