Details for Chinese cabbage Locus Brara.G03525

Position : A07 ( 5`- 26353434 .. 26358154 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03525

Protein [Map View]
MDESGEGGAIAATAIQQTPRRSVRRKLVQSTLLPRKPDDAIESNRDRTCDAANKEDGEEGGDGDFGSSQGKKTRKQRTPK
NNGAPKKMAKGKSPRKQTPKRNATKNGVVAGGDDDDQRTYVSPPVPNLRLEAKLRAEEDSRMSAGKQLHPFFSSRKGGKK
NQEAAAENGSSRDQGKDQIGPIHVFERIQDGYRTIDWKNWTFVEHASTTGSSHQQIKFESLKLGLKEFDLIELPTLSHPV
VCIIDDEDPEKCATQSEAVNLSNNGEDTADVSHELQSGLTRSSLWVDKYQPRSASEVCGNTEAVKLMNEWLCQWRERGFQ
ASQDFLRSDAENSQDADYNCSESDSDSENTDCLKNVLLIIGPVGSGKSAAVYACTKEQGFKIIESNASECRSGTVVKQKF
GEALESNSLSRSLEPLFNSCTDGNGVEDVIEVTPVANLKPLILFEDVDISFAEDRGLVSAIQEIAKKAKGPVVLTANDKN
HGLPDNLERIEICFSLPSTEELFSHLSSVCAAEEVKVNPDSLQRLTISSGGDIRKAIMQLQFWIQSKSKRVRKAKNTGEP
DRFDHKAGHVLLPKIIAQEFPSQLSQFVESEIAKSLSMAEESYDTVEVFVEEVENEKMLDRLWRQGIEKNTIEAKKAAML
RLNTCFEDCDELEDVPSELTDTSYQTLSLSRPNRRRKLNVVMSSDSEDEPLSDINEVSQSVDVSCVPESSYVPETLMDGE
AELSPRAVSCGHFDGRVKASMSEDDDVQNSPSMEIHIKSFDCLMNTCEIIAQSSDGTMMEDCFKDYVESSQKMQQAADEC
SRIDFGMTIKAAQKPKLDTVQESWRKLCSRRADMKPYLDSEPVEAPQLLDITHQITNLISEADLTHSRCLNFVEMEPMMN
ASGDLDTSGIANVLEQMTSTVAQQGFSFFINQIATTGSVPTSSATMQDYTLSSGGCLDMKPETHINVSNCERMVQLSGIL
ESVVPLRSLKGRAFHEYASFIGQISRADPSNVSGAKETTRRRRSVTN*

DNA
ATGGACGAATCAGGCGAAGGAGGCGCGATTGCCGCGACGGCGATCCAGCAGACTCCACGGAGGAGCGTCCGTCGGAAGCT
TGTTCAGTCGACGCTGCTCCCGCGCAAACCAGATGATGCGATCGAGTCGAACCGAGATCGAACATGCGACGCCGCAAACA
AAGAGGACGGCGAAGAAGGAGGAGATGGCGATTTCGGCAGCAGCCAAGGGAAGAAGACGAGAAAACAGAGGACTCCGAAG
AATAACGGAGCTCCCAAGAAGATGGCTAAAGGAAAGTCGCCTCGTAAACAAACGCCTAAGAGAAATGCAACTAAGAACGG
AGTTGTAGCTGGTGGTGATGATGATGATCAACGAACATATGTCTCTCCTCCAGTTCCTAATTTGCGTCTGGAAGCTAAAC
TACGAGCTGAGGAAGATTCGCGGATGTCTGCTGGCAAGCAGTTACATCCCTTTTTCTCATCTCGGAAAGGAGGTAAAAAG
AATCAAGAAGCAGCAGCAGAGAATGGTAGTTCTCGGGATCAAGGAAAGGATCAAATTGGACCTATCCATGTATTTGAGAG
GATTCAGGATGGTTATCGGACCATTGATTGGAAGAACTGGACTTTTGTTGAGCATGCGTCTACTACTGGGAGTTCTCATC
AACAAATAAAATTTGAGTCTCTTAAACTCGGACTCAAAGAATTTGATCTGATTGAGCTTCCAACTCTTTCACATCCTGTT
GTGTGCATCATCGATGATGAAGACCCTGAAAAATGTGCTACTCAGTCAGAAGCAGTTAACTTGTCTAATAATGGTGAGGA
TACAGCAGACGTTTCTCACGAACTGCAAAGTGGCCTGACTCGTAGTAGCTTGTGGGTAGATAAGTACCAGCCGAGAAGTG
CCTCGGAGGTATGTGGTAATACTGAAGCTGTAAAACTAATGAATGAATGGCTCTGCCAATGGCGTGAGAGAGGCTTTCAG
GCAAGCCAAGACTTTTTGAGAAGTGATGCAGAGAATTCGCAAGATGCTGACTACAACTGTTCTGAAAGTGATTCTGACTC
GGAAAATACTGACTGCCTGAAAAATGTTCTCTTAATCATTGGTCCAGTTGGGAGTGGGAAATCTGCAGCTGTTTATGCAT
GTACTAAGGAGCAAGGATTCAAAATCATTGAGTCTAATGCATCGGAATGCCGAAGCGGAACAGTTGTTAAGCAGAAGTTT
GGGGAGGCTCTTGAGTCAAATAGCTTATCAAGGTCCTTGGAACCTCTTTTCAATTCCTGTACTGATGGCAATGGGGTAGA
GGATGTGATTGAAGTGACACCTGTAGCCAACTTGAAGCCTTTAATTCTTTTTGAGGATGTAGATATTTCCTTTGCTGAAG
ATCGTGGTCTCGTGTCTGCTATCCAGGAGATTGCTAAGAAAGCAAAAGGGCCTGTGGTATTGACTGCCAATGACAAAAAT
CATGGTCTGCCAGACAACTTGGAGAGGATAGAGATATGCTTTTCTTTGCCATCAACCGAAGAGCTGTTTAGCCACCTTTC
TTCGGTTTGTGCAGCAGAGGAGGTTAAAGTTAATCCTGATTCACTACAGCGATTGACCATCTCTAGTGGTGGTGATATAC
GGAAAGCGATCATGCAATTACAATTTTGGATTCAGAGTAAATCAAAAAGAGTTAGAAAGGCCAAGAACACTGGTGAGCCA
GATCGATTTGATCACAAAGCTGGTCACGTGCTGCTTCCCAAGATAATTGCGCAGGAATTTCCTTCTCAGTTATCACAGTT
TGTGGAGAGTGAGATCGCTAAATCATTATCCATGGCGGAGGAAAGTTATGACACAGTCGAAGTATTTGTTGAAGAGGTTG
AAAACGAGAAAATGCTTGATAGATTGTGGAGGCAGGGCATAGAAAAGAACACAATAGAAGCCAAGAAAGCAGCCATGTTA
AGGTTGAACACTTGTTTTGAGGATTGTGATGAATTAGAAGACGTTCCATCTGAACTTACCGACACTTCCTACCAAACACT
GTCTCTCTCTCGGCCAAACAGAAGAAGGAAGCTCAATGTTGTGATGTCCTCTGATTCGGAAGATGAACCTCTGAGTGACA
TTAATGAGGTGTCCCAGTCAGTTGATGTATCATGTGTACCAGAATCTTCATATGTTCCAGAAACTTTAATGGATGGGGAA
GCTGAGCTGTCACCAAGAGCAGTATCCTGCGGTCATTTTGATGGAAGAGTTAAAGCATCCATGAGTGAAGACGACGATGT
ACAGAACTCCCCATCAATGGAGATACACATCAAGAGTTTTGATTGCTTGATGAATACGTGTGAGATCATTGCACAATCTT
CTGATGGGACAATGATGGAAGATTGTTTTAAGGATTATGTAGAGAGTTCCCAGAAGATGCAGCAGGCAGCAGATGAATGC
AGCCGTATAGATTTCGGTATGACAATTAAGGCCGCTCAAAAACCGAAGCTTGATACTGTGCAAGAATCATGGAGAAAACT
CTGTTCGAGGCGTGCTGATATGAAGCCATACTTGGATTCAGAACCTGTAGAAGCTCCACAGCTTCTTGACATCACTCATC
AGATAACCAATCTAATCTCAGAAGCTGATCTCACGCACTCTAGATGCCTGAACTTTGTTGAGATGGAGCCAATGATGAAC
GCTTCTGGAGATCTTGACACGTCTGGCATAGCTAATGTGCTTGAACAGATGACTTCCACTGTGGCACAGCAAGGATTTAG
CTTTTTCATAAACCAAATTGCTACAACAGGATCTGTCCCTACTTCATCAGCCACAATGCAGGATTACACATTGAGCAGTG
GAGGCTGCTTGGATATGAAACCAGAAACACATATTAACGTATCAAATTGTGAGCGAATGGTACAGCTTTCCGGCATATTA
GAGTCAGTGGTTCCGCTGAGATCATTGAAAGGAAGAGCTTTCCACGAATATGCTTCATTCATAGGGCAGATTTCAAGAGC
TGACCCCTCTAATGTATCCGGAGCCAAGGAGACAACCAGACGGCGAAGGTCAGTTACCAATTAG