Details for Chinese cabbage Locus Brara.G03524

Position : A07 ( 5`- 26351318 .. 26353136 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03524

Protein [Map View]
MEEGSVFRSLLAILQWWGFNVTVIIMNKWIFQKLDFKFPLSVSCVHFICSSIGAYIVIKVLKLKPLIVVEPEDRWRRIFP
MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAA
LFGCLATSTKTILAESLLHGYKFDSINTVYYMAPFATMILGIPALLLEGNGILSWFDAHPSPWSALIIIFSSGVLAFCLN
FSIFYVIHSTTAVTFNVAGNLKVAVAVMVSWLIFRNPISYMNAVGCGITLVGCTFYGYVRHKLSQQQQPGTPRTPRTPRN
KMELLPLVNNDKLEGKV*

DNA
ATGGAAGAAGGAAGCGTGTTCAGATCTCTGCTAGCGATTCTCCAGTGGTGGGGCTTCAACGTCACCGTCATCATCATGAA
CAAATGGATCTTCCAGAAACTGGATTTCAAGTTTCCTTTATCGGTTTCGTGCGTTCACTTCATATGTTCGTCGATTGGAG
CTTACATCGTGATCAAAGTCCTAAAGCTTAAGCCTTTGATCGTTGTCGAGCCGGAAGATCGGTGGAGGAGGATCTTCCCC
ATGTCTTTCGTCTTCTGCATCAACATTGTGTTGGGGAATGTTAGCCTCCGTTACATCCCTGTTTCGTTTATGCAGACGAT
TAAGTCCTTCACTCCAGCTACTACAGTTGTGTTGCAGTGGCTGGTGTGGAGGAAGTACTTTGACTGGCGTATTTGGGCGT
CTCTTGTCCCTATTGTCGGTGGGATTCTTCTTACTTCGGTTACTGAGCTTAGCTTTAACATGTTTGGGTTCTGTGCTGCT
TTGTTTGGCTGTTTGGCTACTTCTACAAAGACTATTTTAGCTGAGTCTCTTCTTCATGGTTACAAGTTTGACAGCATAAA
CACAGTGTACTATATGGCGCCTTTCGCCACCATGATTCTCGGCATACCTGCGTTACTGCTTGAAGGAAACGGAATCTTGA
GTTGGTTTGATGCACACCCGTCTCCATGGTCAGCGCTCATCATCATCTTCAGCTCCGGTGTGTTAGCCTTCTGTCTCAAC
TTCTCCATCTTCTATGTCATCCACTCAACAACCGCAGTCACATTCAACGTAGCTGGAAACCTCAAGGTTGCGGTGGCTGT
AATGGTGTCATGGTTGATATTCCGTAACCCAATATCGTACATGAATGCTGTTGGATGTGGGATCACGCTTGTGGGCTGCA
CGTTCTATGGATACGTGAGGCATAAGCTTTCGCAGCAGCAGCAGCCGGGAACGCCTAGGACTCCTCGTACACCAAGGAAC
AAGATGGAGTTGCTTCCTCTTGTTAATAACGATAAACTCGAAGGCAAAGTCTGA