Details for Chinese cabbage Locus Brara.G03508

Position : A07 ( 5`- 26266310 .. 26274088 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03508

Protein [Map View]
MDCKENGVSDPSGDENLTSEKAGEDIELITSLETAQAASVTNPALEEDQRECFVEAEQMGEGNSVSKELEENSDAVCCVD
AEQAQGSVSDAIVPGDGTVLPLGVRETDGESVFLNDAPEKVESLETAKDIEDDKAGSDGEGKEGNNEPSSDDVSLIRSCP
FPDSALDSGGLGCSETENDVKSSSDIDGNIPLVVSPSLAITEVLSNSDGGLRSCDLDDIVDKETIDPNLRLVHEDELHTD
LSDKNETLLKNHVGNSSSERDVAGMDDDMAADPRAQSFSRTSPIEENTSGVEANAPITDPSLVRSFPLKFGNGGIGTRNP
ENAVESIRIVDGNGRIGGEVASASGTSESSPRRRSRVGKQGNLSQTNLSAPLPRKSSRKKQSERNLESIFNCSKQKRSSV
SKPDRSSQWGLPCRTAEIFLQSNNIPYGRPPHHETKQPQNSPKNGEHNTQASSGSCLRLKVKFGKSGGQNPLNITVSKVS
GNSLPAGGIVKAGKGLEFPGPADIVEDKLQIVETREQLKEENNSLEKLSCRLLSDSITDEKKNQDAGGLCRKLGGDVLDE
GTHLSSSMVVEEGERANGTRPLDSETSPDSEVINSVQKDLPHGFSSTAEDLVNTNRGLEKQDELLASVSPLENGSHLIPN
AKKSKHPKSKGNGTRKGKSKSKSAKGGRKNESQEGLEQHSFINRSAGSDDSKDHEVGRVESNETTGALLDANIGKPSAVN
GAIWQDGIHGEAVMDLTIEDSSPTESAWVRCDDCFKWRRIPASVVESIDESSRWICMNNSDKDFAHCSISQEMSNEEINE
QLGIGQEEADAYDYEAAKRGKDKEQKSKRLPVNKKACFRAIKTNQFLHRNRKNQTIDEIMVCHCKPPPDGRLGCGEECLN
RMLNIECLHGTCPAGDLCSNQQFQKRKYVKFERFQSGKKGYGLRLLEDVREGQFLIEYVGEVLDMQSYESRQKDYASMGQ
KHFYFMTLNGNEVIDAGAKGNLGRFINHSCEPNCRTEKWMVNGEICVGIFSMKDLKKGQELTFDYNYVRVFGAAAKKCYC
GSSHCRGYIGGDPLNGDVVVQSDSDEEYPELVILDDDESGEGILDATSKIFMDGADMQMPQNSTKVDDSKDLASQSPSSV
AVKLPESEVLPSFQPTEASKELSTDMPVIDVQQEVLEKKTKGPSPASKSISRLSSDGANADKTVKHGSGEAVKILSRPRP
RTKTSRSSGYSKQALPGVNKAQTTPVKKLQQQPIKSKGSEEVSPSGRIETFEGKLNELLDAGGGISKRRDSAKGYLKLLL
LTAASRGNANEGIQSNRDLSMILDALLKTKSRTVLVDVINKNGLQMLHNIMKQYRRDFKKTPILRKLLKVLEYLATRDIL
ALEHIVRPPPYAGMESFKQSILTLTEHDDKQVHQIARNFRDRFIPKHLRKPWRIDREERSESRRSPINSRFRSSQEPRYD
HHSPRRAEPFSSRAATPETPSVSDGCIQPTSSSLPETNGRKRKSRWDQPSTSKEQRTMTDVQDDLPPGFSSPCTDAPNAV
TAQPQAKFLSRLTVSYGIPLSIVHQCGSPCKDDPNSWSVAPGVPFAPFPPLPPVTHGEFFANKGNGTVSASPKRKREFSS
DIGTSYFRQQKQNVPPWIRYNGWEKTVNSSIPEASNCREEDQQSRKS*

DNA
ATGGATTGCAAGGAGAACGGTGTTAGTGACCCTTCCGGGGATGAGAATCTTACCTCTGAGAAGGCTGGAGAAGATATAGA
GTTAATCACTAGTTTGGAGACTGCACAGGCTGCATCAGTTACAAACCCTGCGTTGGAGGAGGACCAGAGGGAGTGCTTTG
TAGAGGCTGAGCAAATGGGAGAGGGTAACAGTGTTAGTAAAGAACTCGAGGAAAACTCTGATGCTGTTTGTTGCGTTGAT
GCTGAGCAAGCTCAAGGATCGGTTTCTGATGCCATTGTGCCTGGTGATGGCACAGTATTGCCCTTAGGGGTCAGGGAAAC
AGATGGTGAATCGGTTTTTCTAAACGATGCACCTGAAAAGGTTGAGTCTTTGGAAACTGCAAAAGATATAGAGGATGATA
AAGCTGGAAGTGATGGTGAAGGCAAGGAAGGAAATAACGAACCATCGAGTGATGATGTTTCTCTCATTCGGAGTTGTCCC
TTTCCAGATTCAGCATTGGATTCTGGGGGTTTGGGTTGCAGTGAGACAGAGAATGATGTGAAGTCTTCAAGTGATATTGA
TGGCAATATCCCTCTCGTGGTATCTCCTTCGTTGGCTATCACGGAAGTGTTAAGTAATAGTGATGGTGGCCTGCGTTCAT
GTGATCTTGATGACATCGTAGACAAAGAGACGATCGATCCAAATTTGAGGTTGGTACATGAGGATGAGCTGCATACTGAT
CTTTCTGATAAGAATGAAACACTGCTAAAGAACCATGTGGGGAATTCATCAAGTGAAAGGGATGTGGCTGGTATGGATGA
TGATATGGCTGCTGATCCGAGAGCTCAAAGTTTCAGTCGGACATCACCCATAGAGGAAAATACCTCTGGTGTAGAAGCCA
ACGCCCCTATTACCGACCCTTCTTTGGTGAGGAGTTTTCCGTTGAAGTTTGGTAATGGAGGCATTGGTACTCGTAATCCT
GAAAACGCAGTGGAGTCGATCAGGATAGTAGATGGCAATGGCAGAATAGGTGGCGAAGTTGCTTCTGCATCTGGGACTAG
CGAGTCTTCACCTCGAAGGAGGTCCCGAGTCGGTAAACAGGGTAATCTTTCGCAGACCAATCTGAGTGCTCCTCTTCCGA
GAAAATCCTCTAGAAAGAAACAATCAGAAAGAAATTTGGAATCAATTTTTAACTGTTCGAAGCAGAAGAGGAGCTCTGTT
TCAAAACCAGACCGTTCATCTCAGTGGGGATTGCCATGTAGGACTGCTGAAATCTTCTTACAGAGCAATAATATTCCTTA
TGGTAGACCTCCGCATCACGAAACAAAGCAACCTCAGAACAGTCCTAAAAATGGAGAGCATAATACCCAAGCATCAAGTG
GCTCTTGCCTTCGTTTGAAAGTTAAATTTGGTAAGTCAGGTGGCCAAAATCCTTTGAACATTACAGTCTCTAAGGTCAGT
GGCAACTCTTTGCCTGCTGGTGGTATTGTTAAGGCCGGAAAAGGTTTAGAGTTTCCAGGGCCTGCAGATATTGTCGAGGA
TAAACTCCAGATTGTGGAAACTAGAGAGCAGTTAAAAGAGGAAAACAATTCCTTGGAGAAACTTTCATGTCGGCTGTTAT
CTGATTCTATTACGGATGAGAAAAAGAACCAAGACGCTGGGGGGTTATGTAGGAAGCTAGGTGGTGATGTTTTAGATGAG
GGTACACACCTTTCCTCTAGTATGGTGGTTGAAGAGGGCGAGAGGGCCAATGGAACCCGGCCCCTGGACTCTGAAACTTC
ACCAGATTCAGAAGTTATCAACTCTGTGCAAAAGGATTTGCCTCATGGTTTTTCCAGCACTGCAGAAGACCTGGTCAACA
CGAACAGAGGATTAGAAAAACAGGATGAATTGCTTGCTTCAGTATCTCCTTTGGAAAATGGTTCACATCTAATTCCCAAC
GCCAAAAAAAGTAAACATCCTAAGTCAAAAGGTAATGGAACAAGAAAAGGGAAATCCAAGTCCAAGTCTGCCAAAGGCGG
GAGAAAAAATGAATCTCAAGAGGGGTTAGAGCAACACAGCTTTATAAATAGGAGTGCTGGAAGTGATGATAGTAAAGATC
ATGAAGTAGGAAGAGTGGAGTCTAACGAAACAACAGGTGCTCTTTTGGACGCTAATATTGGAAAACCCAGTGCCGTTAAT
GGCGCCATATGGCAAGATGGTATTCATGGGGAAGCGGTCATGGACCTTACTATTGAGGATAGCTCTCCCACAGAGAGTGC
TTGGGTTCGATGCGATGATTGTTTTAAATGGCGACGAATACCTGCTTCTGTGGTAGAGTCAATTGACGAGAGCTCGAGAT
GGATCTGTATGAACAACTCAGATAAAGATTTTGCTCATTGCTCAATCTCTCAAGAGATGTCAAATGAAGAAATTAATGAA
CAGTTGGGCATAGGACAGGAAGAAGCAGATGCATATGACTATGAGGCGGCTAAAAGGGGGAAAGACAAGGAACAGAAGAG
CAAACGTTTGCCAGTTAACAAAAAGGCGTGCTTCAGGGCCATAAAAACAAACCAGTTTCTTCATCGTAACCGTAAAAATC
AAACAATAGACGAGATAATGGTTTGTCACTGCAAACCACCACCTGATGGTAGACTGGGTTGTGGAGAAGAATGTCTCAAT
AGAATGCTTAACATTGAATGTCTCCATGGTACATGCCCTGCTGGCGATCTATGCTCAAATCAGCAGTTTCAAAAACGGAA
GTATGTTAAGTTTGAGAGATTCCAATCGGGTAAGAAGGGTTATGGCCTGAGATTGCTTGAGGATGTACGTGAGGGACAAT
TCCTTATTGAATACGTTGGAGAGGTGCTTGATATGCAATCTTATGAGTCTCGTCAGAAGGATTATGCTTCCATGGGTCAG
AAACATTTCTATTTCATGACACTGAATGGGAATGAGGTAATTGATGCTGGTGCAAAGGGAAATTTAGGGCGTTTCATTAA
CCATAGTTGTGAACCAAACTGCCGTACGGAAAAGTGGATGGTGAATGGTGAAATTTGCGTTGGAATATTCTCCATGAAAG
ACCTTAAGAAGGGTCAGGAGTTGACATTTGACTACAACTATGTGAGGGTTTTTGGTGCCGCTGCCAAAAAGTGTTACTGT
GGATCATCACATTGCCGAGGTTACATTGGGGGAGATCCTTTGAACGGTGATGTAGTTGTTCAAAGTGATTCAGATGAAGA
GTATCCCGAACTTGTGATCCTTGATGATGACGAAAGTGGGGAAGGAATCTTAGATGCAACGTCTAAGATCTTCATGGATG
GTGCTGACATGCAAATGCCGCAGAACTCTACAAAGGTTGATGATTCCAAGGACCTTGCTTCCCAATCGCCTAGCTCTGTA
GCTGTAAAACTTCCAGAAAGCGAGGTTCTTCCATCTTTTCAACCGACCGAAGCATCCAAGGAACTTTCGACAGACATGCC
TGTCATTGATGTCCAGCAGGAGGTTCTTGAAAAGAAGACTAAAGGCCCATCTCCCGCGTCCAAGTCTATCAGCAGACTGT
CCTCGGATGGTGCAAATGCTGATAAAACAGTAAAGCATGGATCTGGTGAAGCTGTAAAGATACTTTCACGACCCCGCCCT
CGTACTAAAACTTCGCGTTCATCGGGGTACAGCAAGCAAGCTCTTCCTGGTGTTAACAAAGCACAGACTACACCAGTCAA
AAAGTTGCAACAGCAGCCCATCAAATCTAAAGGATCAGAGGAAGTTTCTCCCAGCGGGCGTATTGAAACATTTGAAGGGA
AACTGAACGAGTTACTAGATGCTGGGGGAGGGATCAGCAAGCGGAGGGATTCAGCAAAGGGCTATTTGAAACTTCTGCTT
CTCACTGCTGCTTCCCGGGGCAATGCCAATGAAGGAATTCAAAGCAATCGAGATCTTTCAATGATTCTTGATGCCCTTTT
GAAGACAAAGTCACGAACTGTTTTGGTGGACGTAATCAACAAGAACGGTCTGCAAATGTTACACAATATCATGAAACAAT
ACCGGAGGGATTTTAAAAAGACCCCAATACTCCGAAAACTTTTGAAGGTATTAGAGTATCTTGCTACAAGGGATATTCTT
GCACTGGAGCATATAGTCAGACCACCTCCTTATGCAGGGATGGAAAGCTTCAAGCAGTCTATTCTAACACTCACCGAGCA
TGATGACAAACAGGTGCATCAAATTGCGAGGAACTTCCGAGACAGATTTATCCCTAAGCATTTAAGAAAACCTTGGCGCA
TCGACAGAGAAGAGAGATCGGAGTCTAGAAGATCACCTATAAACAGCAGATTCAGATCATCACAAGAACCTAGATATGAT
CATCATTCGCCAAGACGTGCAGAACCGTTTTCCTCAAGGGCTGCAACTCCCGAAACACCTTCTGTATCTGACGGGTGCAT
ACAACCTACTTCCTCCAGCCTTCCTGAGACAAATGGACGCAAGCGTAAAAGCAGATGGGACCAGCCGTCTACTTCCAAAG
AGCAACGAACCATGACAGATGTCCAAGACGACCTTCCACCCGGGTTCTCATCGCCTTGCACGGATGCGCCTAACGCAGTC
ACCGCACAGCCACAAGCAAAGTTCCTCTCTCGGTTAACAGTCTCCTATGGGATCCCGCTTAGCATCGTTCATCAGTGTGG
TTCACCCTGCAAAGACGACCCTAATAGCTGGTCCGTTGCTCCTGGGGTGCCGTTCGCACCGTTTCCACCTCTACCACCTG
TTACTCACGGTGAGTTTTTCGCTAATAAGGGAAACGGAACAGTCTCGGCCTCTCCAAAGCGGAAGAGAGAGTTTTCGTCT
GATATAGGAACAAGTTACTTTCGGCAACAGAAACAGAACGTTCCTCCATGGATACGATACAATGGGTGGGAGAAAACAGT
AAACAGCTCCATACCTGAGGCATCTAACTGTAGAGAAGAAGATCAACAATCAAGAAAATCTTGA