Details for Chinese cabbage Locus Brara.G03504

Position : A07 ( 5`- 26243648 .. 26246531 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03504

Protein [Map View]
MIVDEVISNGDGRESSQPNGTLNMANASSGDEKNSRICKRRKLESSVSTVGLSGIRESVACEMNDQRCSGGTHLTGGLPQ
LSNPDESTTEPHKYETVTAGCQNVLSQVLASKEFASLSKLLSENLQGVKIEDLPCRTLIDTRMQEGAYEGSSVLFSTDLQ
EVWKKLQDVGNGMAALAGSLLDLSKTSCTEQLKQFNTVEPTHHPNVETTRNDSVDDACKLCGEKAAVKDYLACDHCDDMY
HVSCAHPGEKEMSSDTWYCLNCTDNGFGSPHENCVVCEKKKTEKLLVKTDNNGCVDDSSAERKEDSNGSEENSTSNMMNH
GDEAMETKIDSELCRTCGTKVEKGDGNRFITCDHPFCPHKYYHIRCLTSKQIKLHNVSWYCSSCLCRNCLTDKDDDKIVL
CDGCDDAYHIYCMKPPCASVPDGEWFCRTCKVAIQKVRKIRNVVEKKKVGAVQKLKGKMNEIKPGSKGKGGLDSGVGGMD
MLLNAADTLKDQEQM*

DNA
ATGATTGTGGATGAGGTGATAAGCAATGGTGATGGTAGAGAGAGTAGTCAGCCTAATGGTACATTGAATATGGCTAATGC
AAGTTCTGGAGATGAGAAGAACTCACGCATATGCAAGCGCAGAAAGCTTGAGAGCTCGGTTTCTACGGTTGGTCTCTCAG
GAATCCGGGAGTCTGTCGCTTGTGAAATGAATGATCAAAGGTGCAGCGGAGGAACTCATCTTACTGGTGGACTCCCCCAG
CTTTCAAATCCAGATGAATCAACAACCGAACCCCACAAGTATGAGACTGTGACAGCCGGTTGCCAGAATGTTCTGTCTCA
AGTTTTAGCTTCAAAGGAGTTTGCGTCCCTCAGTAAGTTGCTTTCCGAGAATCTTCAAGGGGTCAAGATTGAAGACCTTC
CCTGCAGAACTTTGATAGACACAAGGATGCAAGAGGGTGCTTATGAAGGTTCATCTGTACTCTTCTCAACGGATCTCCAA
GAGGTCTGGAAAAAACTACAGGATGTTGGTAATGGTATGGCTGCTCTTGCTGGTAGTCTCTTGGATCTTTCAAAGACCTC
ATGTACCGAACAGTTGAAGCAGTTCAACACTGTGGAACCTACGCATCATCCGAATGTAGAGACCACCAGAAACGACAGTG
TTGATGACGCTTGCAAGCTATGTGGAGAGAAGGCAGCGGTAAAGGACTATTTAGCTTGTGATCATTGTGATGATATGTAC
CATGTCTCATGTGCACATCCTGGTGAGAAAGAGATGTCTTCAGACACTTGGTATTGCCTAAACTGCACAGATAATGGATT
CGGATCACCTCACGAGAATTGCGTTGTGTGCGAGAAAAAGAAAACCGAAAAGCTGCTGGTGAAGACAGATAACAACGGAT
GCGTTGATGATTCGAGTGCAGAACGTAAAGAAGACTCAAACGGATCAGAAGAGAATTCAACATCCAACATGATGAATCAT
GGTGATGAAGCCATGGAGACAAAGATAGATTCTGAGCTCTGCAGGACATGTGGAACAAAAGTGGAGAAAGGCGATGGTAA
CAGGTTCATCACATGCGATCACCCGTTCTGCCCACACAAGTACTACCACATCAGGTGTCTGACTTCAAAGCAGATAAAGC
TACACAATGTCAGCTGGTACTGCTCCTCGTGCTTATGCAGAAACTGCTTAACCGACAAGGATGATGATAAAATTGTCTTG
TGCGACGGGTGCGATGATGCTTACCACATCTACTGCATGAAGCCTCCGTGTGCGTCGGTTCCAGATGGAGAATGGTTTTG
CAGGACTTGTAAAGTTGCGATCCAGAAAGTGCGCAAGATTCGAAATGTGGTTGAGAAGAAGAAGGTGGGGGCTGTGCAGA
AACTGAAAGGGAAGATGAACGAGATCAAACCGGGAAGTAAAGGCAAAGGAGGGTTGGATAGTGGCGTAGGAGGGATGGAT
ATGCTTCTTAACGCAGCTGACACATTGAAAGATCAAGAACAGATGTGA