Details for Chinese cabbage Locus Brara.G03502

Position : A07 ( 5`- 26237029 .. 26239815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03502

Protein [Map View]
MEWRGIICTLFFILSIGESSSRFRIMWLPNLGAGVDFSGTYFTWPILSASVFVTVAILISMYLIFEHLASYNQPEEQKFL
IGLILMVPVYALESFLSLVNSEAAFNCEVIRDCYEAFALYCFERYMIACLDGEERTIEFMEQQTVITQTTPLLEGTCSYK
VVEHPFPMNCFLKDWNLGPQFYHAVKIGIVQYMILKMICALLAMLLEAFGVYGEGKFQWNYGYPYLAVVLNFSQTWALYC
LVQFYNVIKDKLAPIKPLAKFLTFKSIVFLTWWQGIIVAFLFSMGIFKGSLAKELKTRIQDYIICIEMGVAAVVHLYVFP
AAPYKRGERCVRNVAVMSDYASIDTPPDPEEVKDSERTTRVRYGRHDDEREKRLNFPQSVRDVVVGSGEIIADDMRFTVS
HVVEPVERGIAKINRTFHQISENVKRFEQKKRRTKDDSYVIPLNPWTKEFSEVHEDLHEGGSVSDSGLGSTKRRQQSRVS
GLWSRMRR*

DNA
ATGGAGTGGAGAGGAATCATCTGCACTCTCTTCTTCATTCTTTCCATTGGAGAGTCTTCTAGTAGGTTCAGGATCATGTG
GCTTCCTAACCTCGGTGCTGGTGTTGATTTTTCTGGAACATACTTCACTTGGCCAATCTTAAGTGCCAGCGTCTTCGTTA
CTGTCGCCATCCTCATCTCCATGTATCTCATCTTTGAGCACCTAGCTTCTTATAACCAGCCTGAGGAACAGAAGTTTCTG
ATTGGACTTATTCTCATGGTCCCTGTCTATGCCCTGGAATCGTTTCTGTCTTTGGTGAACTCAGAAGCAGCTTTTAACTG
CGAGGTGATTCGAGATTGTTATGAAGCCTTTGCTCTCTACTGCTTTGAGAGATACATGATAGCTTGCCTAGATGGAGAGG
AACGTACGATTGAATTCATGGAGCAACAGACAGTGATCACCCAGACCACTCCTCTTCTCGAAGGCACATGTTCTTATAAA
GTTGTGGAGCATCCTTTCCCAATGAACTGCTTCCTTAAAGACTGGAACCTTGGTCCTCAGTTTTATCACGCTGTCAAAAT
TGGCATCGTTCAATATATGATACTGAAGATGATCTGTGCTCTATTAGCAATGCTCCTTGAAGCCTTTGGAGTTTATGGAG
AAGGCAAGTTCCAATGGAACTACGGGTATCCATATCTGGCTGTCGTCCTGAACTTCAGCCAAACATGGGCACTGTATTGC
CTTGTGCAGTTCTACAACGTCATCAAAGACAAGCTAGCACCCATCAAACCATTAGCCAAGTTCTTAACCTTCAAGTCTAT
TGTATTCCTCACCTGGTGGCAAGGCATCATCGTCGCGTTCCTCTTCTCCATGGGGATTTTCAAAGGGTCTTTAGCTAAGG
AGCTCAAAACGCGTATACAAGACTACATCATCTGCATCGAGATGGGTGTTGCAGCTGTGGTTCATCTCTACGTCTTCCCA
GCTGCTCCCTACAAGCGCGGGGAGAGATGCGTCCGCAACGTAGCGGTGATGTCGGATTACGCTTCTATAGACACGCCTCC
TGATCCGGAGGAGGTTAAGGACAGCGAGAGAACGACTAGGGTGAGGTACGGGAGGCATGATGATGAGAGGGAGAAGCGGT
TGAATTTTCCTCAGAGCGTGCGTGATGTGGTGGTGGGGAGCGGCGAGATCATTGCGGATGACATGAGGTTCACTGTTTCT
CACGTGGTGGAGCCGGTGGAGAGAGGGATAGCGAAGATTAACAGGACGTTTCATCAGATATCTGAAAACGTGAAGAGGTT
TGAGCAGAAGAAGAGGAGGACTAAAGATGATTCGTATGTGATTCCGCTGAACCCGTGGACGAAAGAGTTCTCTGAGGTTC
ATGAGGATCTTCATGAAGGAGGGAGTGTGAGTGATAGCGGTTTGGGGAGTACGAAGCGGCGTCAACAGTCTAGAGTCTCG
GGACTGTGGAGTAGAATGCGAAGGTGA