Details for Chinese cabbage Locus Brara.G03500

Position : A07 ( 5`- 26226078 .. 26226815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03500

Protein [Map View]
MTESSISSVKQPSPVEEETHHHREDEETHRTNKKKRARPDPCYRGVRMRTWGKWVSEIREPRKKSRIWLGTFSTAEMAAR
AHDAAALTIKGPSAVLNFPELATFLPRPASSSPRDVQAAAAVAAAMDFSSSSSSAVVISDPTTVVPESQLSSSSSYLSFT
SSSTLSPSSEEAASSTAEELSEIVELPSLETSYDEPWSEFVYVDPAYPPSSPWYFNNCYSFYYHSDETGTSMGEPFDSSN
FCLFP*

DNA
ATGACCGAGTCATCCATTTCCTCCGTCAAACAACCTTCTCCGGTGGAAGAGGAGACTCATCACCACCGAGAAGATGAAGA
GACCCATCGAACAAATAAGAAGAAACGGGCTAGACCCGACCCGTGTTATAGAGGCGTACGGATGCGAACGTGGGGCAAAT
GGGTCTCCGAGATCCGCGAGCCACGCAAGAAGAGCCGAATCTGGCTCGGCACCTTCTCCACGGCGGAGATGGCGGCGCGT
GCGCACGACGCAGCTGCTTTAACCATCAAAGGACCCTCCGCCGTCCTCAACTTCCCGGAGCTAGCCACTTTCCTTCCTCG
TCCAGCTTCCTCCTCTCCACGCGACGTTCAAGCTGCAGCCGCCGTAGCCGCCGCCATGGACTTTTCCTCCTCCTCCTCCT
CTGCCGTCGTTATCTCTGATCCCACCACCGTTGTCCCCGAGTCGCAGTTATCTTCTTCAAGTAGCTACTTGTCGTTTACA
TCGTCTTCAACGTTGTCACCGTCGAGCGAAGAAGCAGCATCATCAACGGCGGAAGAACTGAGCGAGATAGTCGAGTTGCC
GAGTCTAGAGACGAGTTACGATGAGCCGTGGAGCGAGTTCGTGTACGTTGACCCGGCGTATCCACCTAGTTCGCCTTGGT
ATTTTAATAACTGTTATAGCTTTTATTACCACAGCGACGAAACTGGCACTTCGATGGGTGAACCTTTTGACTCTTCCAAC
TTTTGTCTTTTTCCTTAG