Details for Chinese cabbage Locus Brara.G03499

Position : A07 ( 5`- 26220400 .. 26222843 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03499

Protein [Map View]
MELTMASLKDRLPPAKSTAATFYDHSNDPWFKNRFTESESEKTAAVVFKAVPVYLKRQGFRPRNPEDFGDGGAFPEIHVA
QYPLGMGKNKSNKPGAKTLPVTVDAQGNVMFDAIVRQNENSKKIVYSQHKDIIPKVLKNEGGEDGVVDEEEELQKQIQET
TEETKAAMEKIVNVRLSAAQPTNVPRQSGDSKFIKFKPSQQSSAFNSGAKERIIRMVEMPVDPLDPPKFKHKRVPKASGS
PPVPVMHSPPRPVTVKDQQDWKIPPCISNWKNPKGYTIPLDKRLAADGRGLQDVQINDNFAKLSEALYVAEQKAREAVSM
RSKVQKEMMMKEKERKEQELRALAQKARSERTGAPASMPVSVDRARSESVDPRGDYDYDRDREREREREREGPKESREEK
DRMRREEIRRERRHERERERRLEAKDAAMGKKSKITRDRDRDISEKVALGMASTGGKGGEVMYDQRLFNQEKGMDSGFAT
DDQYNVYDKGLFTAQPTLSTLYKPKKDTDEEMYGNADEQLDKLKNTERFKPDRAFTGASERSGKRERPVEFEKEEQDPFG
LDRFVSDVNKGKKKPLDKIGSGGTMRASGGGGSSSRDDYGGSGRTKINFERGDR*

DNA
ATGGAGCTTACTATGGCGTCTCTTAAGGACCGTCTACCTCCGGCCAAATCAACAGCCGCCACGTTCTACGACCACTCCAA
CGATCCATGGTTCAAGAACCGTTTCACCGAGTCCGAATCCGAGAAAACCGCCGCCGTGGTTTTCAAAGCGGTGCCTGTTT
ACCTGAAGCGTCAAGGCTTCCGTCCTAGGAACCCTGAGGATTTTGGAGACGGTGGCGCTTTCCCTGAGATACACGTTGCT
CAGTATCCCCTTGGGATGGGGAAGAATAAGTCTAACAAGCCTGGGGCTAAGACGCTTCCTGTTACTGTTGATGCTCAAGG
GAATGTGATGTTTGACGCTATTGTGAGGCAGAACGAGAACTCGAAGAAGATTGTTTACTCTCAGCATAAGGATATTATCC
CCAAGGTGCTGAAGAACGAGGGGGGAGAGGATGGTGTTGTGGATGAAGAGGAGGAGTTGCAGAAGCAGATTCAGGAGACT
ACTGAGGAGACGAAAGCTGCTATGGAGAAGATTGTGAATGTGAGGCTGAGTGCTGCGCAGCCTACTAATGTCCCGAGGCA
GTCAGGAGACTCGAAGTTTATTAAGTTTAAGCCTTCTCAGCAGTCTTCGGCTTTTAATTCAGGTGCTAAAGAGAGGATTA
TTAGGATGGTGGAGATGCCTGTGGATCCTCTTGATCCGCCGAAGTTTAAGCACAAGAGAGTCCCCAAGGCTTCTGGCTCT
CCTCCTGTTCCTGTCATGCATTCGCCGCCCAGGCCTGTTACAGTCAAGGACCAGCAAGACTGGAAGATCCCTCCATGTAT
CTCTAACTGGAAGAATCCGAAGGGTTACACTATCCCTCTTGATAAACGTCTTGCTGCTGATGGAAGAGGTTTACAAGATG
TTCAGATTAATGATAACTTTGCCAAACTATCTGAGGCTCTCTATGTTGCTGAGCAGAAAGCTAGGGAGGCAGTTTCGATG
CGGTCAAAGGTGCAAAAGGAGATGATGATGAAGGAGAAGGAAAGGAAAGAGCAGGAATTGAGGGCTCTTGCTCAAAAAGC
TCGTTCTGAGAGAACTGGTGCTCCTGCGAGCATGCCTGTCTCTGTAGACAGGGCTAGGAGTGAGAGTGTTGACCCGAGAG
GTGATTATGACTATGACCGTGACCGTGAGAGGGAAAGGGAAAGAGAGAGGGAAGGGCCAAAGGAGAGTAGAGAGGAGAAG
GATCGGATGCGGAGGGAGGAGATCCGAAGAGAGCGTCGCCACGAAAGAGAAAGGGAGAGAAGGTTGGAAGCTAAAGATGC
AGCCATGGGGAAGAAGAGCAAGATCACGAGAGACAGAGACCGTGATATCAGCGAGAAAGTCGCTCTTGGAATGGCCTCTA
CAGGAGGCAAAGGCGGCGAAGTTATGTACGATCAACGTCTCTTCAACCAAGAGAAGGGAATGGATTCCGGTTTCGCAACC
GACGACCAGTACAACGTATACGACAAAGGCTTGTTCACTGCACAACCCACTCTCTCAACGCTCTACAAGCCTAAGAAGGA
TACGGATGAAGAAATGTACGGAAACGCAGACGAGCAGCTCGATAAGCTCAAGAACACCGAGAGGTTCAAACCAGACAGAG
CTTTCACCGGTGCTTCCGAGAGGTCGGGCAAGAGAGAACGACCTGTGGAGTTCGAGAAGGAAGAACAAGATCCTTTCGGT
CTGGACCGTTTCGTGTCTGACGTGAACAAAGGCAAGAAGAAGCCTTTGGACAAAATCGGATCTGGTGGAACTATGAGAGC
AAGCGGCGGTGGCGGCAGCTCTTCACGCGATGACTATGGTGGTTCTGGTCGAACCAAAATCAATTTCGAACGTGGTGATC
GTTAA