Details for Chinese cabbage Locus Brara.G03496

Position : A07 ( 5`- 26199945 .. 26201016 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03496

Protein [Map View]
MGSLGKEDLDKLVLDYIEPPVTVQPVTVPPATVPNHMEKSSTALVTLQEILRTKGEKEKEMEEKVNSFIIRRLSYEGDDE
KRDVMKKIVSKLRSDGYNDVSIYRTSWDSSFDRREGCSRMFKCKRKYEYIEVMVATGRGGDDRSKMKRLIIDLDFKSQFE
LAKQTEVYKDVTQMLPTVFVATEERLKRVVSLVSGEMTESMKKEGMSRPPWRTTRYMLAKWLPEKRVSSSKKGSWSMFDD
DGGEAVETTSGIGFKTTCGFQLS*

DNA
ATGGGGAGTTTGGGAAAAGAAGATCTGGACAAGCTTGTGCTGGATTATATTGAGCCTCCGGTCACCGTCCAACCGGTCAC
CGTTCCTCCGGCCACCGTCCCCAATCATATGGAGAAGTCTTCAACTGCTCTAGTAACCCTTCAGGAGATTCTTCGGACGA
AAGGAGAAAAGGAGAAGGAAATGGAAGAGAAGGTAAACTCGTTTATCATAAGAAGATTATCATACGAAGGAGACGATGAG
AAGAGAGATGTGATGAAAAAAATTGTCTCCAAGCTTAGATCTGACGGCTACAATGATGTTTCTATCTATAGAACCTCGTG
GGATTCTTCTTTTGATCGCCGTGAAGGATGTAGTAGAATGTTTAAGTGCAAGAGGAAGTACGAGTACATTGAGGTCATGG
TGGCGACTGGTCGCGGCGGTGATGACAGAAGCAAGATGAAACGTCTCATTATTGATCTTGACTTCAAGTCTCAGTTTGAG
TTAGCGAAACAGACAGAAGTTTACAAAGACGTGACTCAGATGCTTCCGACAGTGTTTGTGGCGACAGAGGAGAGACTCAA
AAGAGTTGTTTCGTTGGTTTCTGGTGAGATGACAGAGTCCATGAAGAAAGAAGGAATGTCTAGACCGCCATGGAGGACTA
CGAGATACATGCTAGCCAAGTGGCTACCTGAGAAAAGGGTCTCTAGTTCTAAGAAAGGATCCTGGTCTATGTTTGATGAT
GATGGAGGTGAAGCTGTTGAGACAACGAGTGGTATTGGTTTTAAAACTACGTGTGGTTTCCAGTTATCTTAG