Details for Chinese cabbage Locus Brara.G03493

Position : A07 ( 5`- 26188734 .. 26192236 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03493

Protein [Map View]
MITGSEFYKVMCAMAPLYFAMFVAYGSVKWWKIFTAEQCSGINRFVSVFAVPILSFHFISQNNPYKMDMMFIIADTLSKV
MVFVLLSLWAILFKSGGLDWLITLFSVATLPNTLVMGIPLLQAMYGEYTQNLMVQLVVLQCIIWYTLLLFLFELRAARLL
IRTEFPGQAAGAITRIQVDDDVISLDGMDPLRTETETDINGRVRLRIRRSISSVPDSVVSSSLCLTPRASNLSNAEIFSV
NTPNRFFNGGGGSGALQFYNGNNEIMFCNGDLGGFGFTRPGCGVSPRRLSGYASSDAYSLQPTPRASNFNELDVNGAGTP
VWMKSPVAGRIYRHTASPKMTWESGQRHVAKDTINEKEISFRDALRAAPPPTAAGVACSMEEGAAGKETAPVAPIGRQEM
PSAALMVRLILTVVGRKLSRNPNTYSSIIGLVWSLISFRWNIALPDIVAFSIKIISDAGLGMAMFSLGLFMALQPKMITC
GVKKATVGMLIRFILGPAFMAAASVIVGLKGSRLHAAIVQAALPQGIVPFVFAREYGLHPDLLSTLVIFGMIVSLPVTIL
YYVLLGL*

DNA
ATGATCACGGGAAGTGAATTCTACAAAGTGATGTGTGCAATGGCACCACTCTACTTCGCCATGTTCGTTGCCTACGGTTC
TGTCAAGTGGTGGAAGATCTTCACGGCGGAGCAATGCTCTGGAATCAACCGTTTTGTCTCGGTTTTCGCCGTCCCTATTC
TCTCTTTCCACTTCATCTCACAAAACAACCCTTACAAAATGGACATGATGTTCATCATCGCTGACACTTTGTCTAAAGTC
ATGGTCTTCGTTTTGCTCTCGCTATGGGCCATTCTCTTCAAGTCTGGTGGTCTCGATTGGCTCATCACTCTCTTCTCCGT
CGCCACGCTCCCTAACACTCTCGTTATGGGCATCCCTTTGCTTCAGGCCATGTACGGAGAGTACACTCAAAACCTCATGG
TCCAACTCGTTGTCCTTCAATGCATCATTTGGTATACTCTACTACTCTTCCTCTTTGAACTACGTGCGGCCAGGTTGCTT
ATCCGAACCGAGTTTCCGGGTCAAGCAGCCGGGGCAATCACTAGGATCCAAGTCGATGATGACGTCATCTCCTTAGACGG
CATGGACCCTCTCCGTACAGAAACTGAAACCGATATAAACGGTCGGGTCAGGCTGAGGATCCGACGGTCCATATCATCCG
TACCCGACTCCGTTGTCTCTTCCTCTCTATGCCTAACCCCTCGAGCCTCGAATCTTTCTAACGCCGAGATTTTCTCCGTC
AACACTCCTAACCGTTTCTTTAACGGCGGAGGAGGAAGTGGTGCACTTCAGTTTTATAACGGTAATAACGAGATCATGTT
TTGTAACGGTGATCTAGGCGGTTTCGGTTTTACCCGGCCCGGGTGTGGTGTTAGCCCTAGGAGACTATCGGGTTATGCTT
CTTCAGATGCTTACTCGTTGCAGCCGACGCCACGTGCCTCGAACTTCAACGAGCTTGACGTTAACGGAGCCGGTACGCCG
GTTTGGATGAAGTCTCCTGTCGCCGGGAGAATATACCGGCATACAGCGTCGCCAAAGATGACATGGGAGTCAGGGCAGAG
ACATGTAGCCAAGGATACTATCAATGAGAAGGAGATCAGCTTCAGAGACGCACTTAGGGCTGCACCACCGCCTACGGCAG
CCGGTGTTGCTTGTTCCATGGAGGAAGGAGCCGCCGGAAAAGAAACAGCTCCGGTTGCTCCTATTGGCAGGCAAGAAATG
CCAAGTGCCGCTTTGATGGTGCGGCTCATACTAACTGTCGTGGGGCGCAAGCTTTCTCGAAACCCCAACACCTATTCTAG
CATAATAGGTCTTGTCTGGTCACTTATATCCTTCAGATGGAATATAGCGTTGCCAGATATTGTTGCGTTTTCGATAAAGA
TAATATCAGATGCAGGTCTTGGAATGGCCATGTTTAGTTTAGGTCTATTCATGGCGTTACAGCCGAAGATGATCACTTGT
GGGGTGAAGAAAGCAACAGTGGGGATGTTGATTAGGTTCATCTTAGGTCCCGCTTTCATGGCTGCTGCTTCAGTTATCGT
TGGATTGAAAGGTTCTAGGTTACATGCTGCCATCGTACAGGCGGCTCTACCGCAAGGAATAGTTCCGTTCGTGTTTGCGA
GGGAGTATGGTTTGCATCCAGACTTACTCAGTACATTGGTTATCTTTGGTATGATAGTATCTTTACCAGTAACTATTCTG
TATTACGTGCTGTTGGGCCTATGA