Details for Chinese cabbage Locus Brara.G03492

Position : A07 ( 5`- 26183112 .. 26184404 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03492

Protein [Map View]
MSRGVRESISKHSFSSRMIIIGIFLVLFSAHDLFSFSEAQQLQFGFYSETCPSAESIVGDVVKQAVTKDPRNAAVLLRLH
FHDCFVEGCDGSILIKHEVNDDERFAPGNAGVGGFDVIDNAKSELERLCPGVVSCADIVALAARNAVVAAKGPFYEVPTG
RRDGLTSDKSNAANLPDVEDSINILKSKFREKGLSDKDLVLLSAGAHTIGTTACFFIMSRLDAQDSTISPEFFQVLRSKC
PKGGDVNVRIPLDWESQFVFDEQIFRNIRDGKGVIKSDSVLYQDNDMKNIIESYLASNESSEANFAADFAEAMVTMGAIG
VKTGVKGEVRRICNATN*

DNA
ATGAGCCGTGGAGTACGAGAGAGTATATCGAAGCATTCATTTAGTTCGAGAATGATCATTATTGGAATCTTTCTAGTTTT
GTTTTCTGCTCATGATCTATTCAGTTTTTCAGAGGCACAACAACTCCAGTTTGGGTTCTACTCAGAAACATGTCCATCCG
CAGAATCCATCGTCGGTGACGTTGTTAAACAAGCAGTGACCAAGGACCCTAGAAATGCTGCTGTCTTACTCCGTCTCCAC
TTCCATGATTGCTTTGTTGAGGGTTGTGATGGGTCTATTCTTATCAAACACGAAGTAAATGATGACGAGAGGTTTGCTCC
GGGTAACGCTGGTGTGGGTGGTTTCGATGTTATAGATAATGCCAAATCAGAGCTTGAACGTTTGTGTCCAGGCGTTGTGT
CTTGTGCTGACATCGTTGCTCTTGCTGCTAGAAACGCTGTCGTTGCGGCAAAAGGACCTTTTTACGAGGTTCCAACAGGT
CGAAGAGATGGCCTGACATCAGATAAGAGTAACGCTGCTAACTTGCCAGATGTTGAAGATTCCATAAACATTTTGAAATC
AAAATTCAGAGAAAAGGGGCTTTCAGATAAAGATCTTGTTCTTCTTAGTGCTGGTGCACATACTATCGGTACTACAGCAT
GTTTCTTTATCATGTCACGTTTGGATGCTCAAGATTCAACGATAAGTCCAGAATTTTTTCAAGTGTTGAGATCAAAGTGT
CCAAAAGGTGGCGATGTTAATGTAAGGATTCCGTTGGATTGGGAAAGCCAGTTTGTGTTCGACGAGCAAATATTTAGGAA
CATCAGAGATGGCAAAGGAGTTATCAAATCGGATTCTGTACTGTACCAAGATAATGACATGAAGAATATTATTGAGTCGT
ATTTGGCAAGCAACGAGAGTTCGGAGGCTAATTTTGCTGCGGATTTTGCTGAAGCTATGGTAACGATGGGTGCCATTGGG
GTGAAGACTGGTGTTAAAGGAGAGGTCAGACGCATATGCAATGCCACAAATTAG