Details for Chinese cabbage Locus Brara.G03491

Position : A07 ( 5`- 26180982 .. 26182474 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03491

Protein [Map View]
METALLRFRVSFSCHPHPHHKKIAAHHRVNNEIPGGSEDEWSPKVLSRRSLLATVSGLSLVSSTSLAFPGEGLAVVKQGL
LAGRVPGLSEPDDEGWRTYRRPDEKSGGHGVGWSPIIPYAFSVPQDWNEVPVSIADLGGTEIDLRFASPKEGRLSVIVAP
VLRFADNLGDNVKIENIGTPAKVINAFGPEVIGENVEGKVLSSNVAEHEGRLYYQFELEPPHVLITATAAGNRLYLFSVT
GNGLQWKRYYKDLKKIATSFRVV*

DNA
ATGGAGACGGCCCTGCTTCGGTTCCGCGTTAGTTTCTCCTGTCATCCTCATCCACACCACAAGAAAATCGCCGCTCATCA
CAGAGTCAACAATGAGATTCCTGGAGGATCTGAAGACGAGTGGTCTCCTAAGGTTTTGAGTAGAAGATCATTACTAGCGA
CTGTTTCTGGACTCTCACTGGTCTCTTCGACGTCTTTAGCGTTTCCAGGGGAAGGGTTAGCTGTCGTGAAACAAGGTCTT
CTCGCCGGGAGAGTTCCCGGTCTGTCCGAACCCGATGACGAAGGTTGGAGAACATACCGTAGACCAGACGAGAAGTCAGG
AGGGCATGGCGTTGGTTGGAGTCCTATTATCCCTTACGCCTTCTCTGTTCCTCAAGATTGGAATGAGGTACCTGTATCGA
TAGCTGATCTTGGTGGAACTGAGATTGACTTGAGATTTGCTAGTCCTAAAGAAGGCCGCTTGTCCGTAATTGTCGCTCCC
GTTCTAAGATTTGCAGATAACCTTGGGGACAACGTGAAGATTGAAAACATTGGAACACCAGCGAAGGTGATCAACGCCTT
TGGACCAGAAGTTATTGGAGAAAACGTTGAAGGGAAAGTGTTGAGTTCAAATGTAGCGGAACACGAGGGTAGACTCTATT
ACCAGTTCGAGCTAGAGCCACCTCATGTACTCATCACCGCAACAGCCGCTGGAAACCGCCTTTACCTGTTCAGTGTCACC
GGAAACGGGCTTCAATGGAAGAGATACTACAAGGATCTGAAGAAGATAGCTACTTCCTTCCGAGTTGTCTAG