Details for Chinese cabbage Locus Brara.G03490

Position : A07 ( 5`- 26178407 .. 26180250 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03490

Protein [Map View]
MSMLMAVKPTSLCNTLNLTASPRSPRTNPRAARLVNPTARIQTRIHRLIQDQGIILMPGCYDALSAAIVQQTGFSAGFIS
GYALSASLLGKPDFGLLTPPEMAATARSVCASAPNIPIIADADTGGGNALNVQRTVKDLIAAGAAGCFLEDQAWPKKCGH
MRGKQVISAEEHAAKIASARDAIGDSDFFLVARTDARATSAKSGLEDAIARVNLYMEAGADASFVEAPRDDEELREIGKR
TKGFRVCNMIEGGVTPLHTPEELKEMGFHLIVHPLTALYASARALVDVLKTLKENGTTRGHLEKMATFEEFNSLVDLESW
FELEARYSNLRNALGTTTKS*

DNA
ATGTCGATGCTCATGGCGGTCAAACCCACTTCCCTATGCAACACCTTAAACCTTACGGCTTCACCGAGATCCCCACGCAC
CAATCCTCGCGCGGCGAGATTGGTTAATCCGACGGCGAGGATCCAAACACGTATCCATCGTCTGATCCAAGACCAAGGCA
TTATCCTCATGCCTGGATGCTACGACGCGTTATCAGCCGCCATCGTTCAGCAAACCGGATTCTCCGCCGGTTTCATCTCC
GGTTACGCTCTCTCCGCTTCTCTTTTGGGTAAACCGGACTTCGGTTTGCTAACTCCACCGGAGATGGCTGCGACGGCAAG
GTCGGTCTGTGCTTCGGCTCCAAACATACCCATCATTGCAGATGCTGACACTGGTGGAGGAAATGCACTAAATGTCCAAA
GAACTGTAAAGGACTTGATCGCAGCTGGTGCTGCTGGTTGCTTCCTTGAGGACCAAGCATGGCCAAAGAAATGCGGTCAT
ATGCGTGGGAAGCAAGTTATCTCAGCCGAAGAACACGCTGCCAAGATAGCATCAGCACGAGACGCTATAGGAGACTCTGA
CTTCTTCCTTGTCGCGAGAACCGACGCACGTGCCACTTCTGCTAAGTCAGGGCTCGAGGACGCCATTGCGCGTGTCAATC
TCTACATGGAGGCGGGAGCGGATGCTTCCTTTGTGGAGGCACCGAGAGACGATGAAGAGCTCAGGGAGATAGGCAAACGC
ACAAAGGGTTTCAGAGTCTGCAACATGATCGAAGGAGGAGTCACGCCGCTGCACACGCCCGAGGAGCTTAAGGAAATGGG
GTTTCACTTGATTGTTCACCCCTTGACCGCGCTCTACGCTTCGGCTAGAGCGCTGGTGGATGTTCTCAAGACTCTTAAAG
AAAACGGAACCACGAGAGGTCACTTGGAGAAGATGGCTACTTTTGAGGAGTTCAATAGTTTGGTGGATTTGGAGTCGTGG
TTTGAGCTCGAGGCTCGTTACTCGAACCTTAGGAACGCCCTTGGGACGACTACAAAGTCATGA