Details for Chinese cabbage Locus Brara.G03486

Position : A07 ( 5`- 26156329 .. 26157873 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03486

Protein [Map View]
MFDPSSKSFSTHLIFPRTFDDHPDSGVCSPPLWKNSPPHVQTNYHSLSPVSKAQVIARGQRELMEMISKMPESCYELSLK
DLVEVKTEEENDRKVFDEMPQRRKKQSKAVRKVKSDKWVDPVRNGGVNNSGFLLKLGFPVSLGAKKRTKKKKGEDDDASV
TSRGSWFSSPRGSFSEDKDWLKSESGRSQRGVSRINSGSSKSSGGSSSRSNSDRSRRSLSDEKSGCLSFLRSVHARD*

DNA
ATGTTTGATCCTTCTTCGAAATCGTTCAGTACCCATTTGATATTCCCCAGAACGTTCGATGATCATCCAGATTCCGGCGT
CTGTTCGCCTCCTCTGTGGAAGAACAGTCCTCCTCACGTTCAAACCAATTACCACAGCCTCTCCCCCGTTTCCAAGGCTC
AGGTGATCGCTCGTGGCCAGCGAGAGCTTATGGAGATGATTAGCAAGATGCCCGAGTCGTGCTACGAGCTCTCCTTGAAG
GATCTCGTGGAGGTGAAAACAGAGGAAGAGAATGATCGGAAGGTGTTCGACGAAATGCCTCAGAGAAGGAAAAAGCAGAG
TAAAGCTGTGAGGAAGGTGAAGAGCGACAAATGGGTCGACCCGGTTCGAAACGGAGGTGTGAACAATAGTGGGTTTCTTC
TGAAATTAGGGTTTCCTGTTAGCTTGGGTGCTAAGAAAAGGACGAAGAAGAAGAAGGGTGAGGATGATGATGCTTCTGTG
ACGAGTAGAGGCTCTTGGTTTTCTTCTCCGAGAGGTTCCTTTTCGGAGGATAAAGATTGGTTGAAGTCAGAATCTGGTAG
GAGTCAGAGAGGTGTGTCAAGGATTAACAGTGGGAGCTCAAAGAGTAGTGGTGGTAGTAGCAGCAGAAGCAACAGTGATC
GAAGCCGAAGGAGTCTAAGCGATGAAAAGAGCGGATGCCTATCTTTCCTCCGGAGTGTACATGCACGAGATTAA