Details for Chinese cabbage Locus Brara.G03482

Position : A07 ( 5`- 26146010 .. 26146774 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03482

Protein [Map View]
MKIISLTLIPFLISMAPYPILSKAPFGTPSAGGGSVGFNAPTGPGYRSGDTAPGGSSGINGPNGPGYRSGGPGGYKSGDT
SAGYRNGSPPGKRVGGGDPGAAIVVFPKKPVPTPVPAECKPIAGCVTKHIAGGNPTVPQYHGPCCNQFKNKVSCVCKFLM
STNAKQQRAADGVVRGCNFKNPICIKKPMPAACRPEVKHCVEMHMYRRASNPTFGSPCCQKFKTSKRCIMAFKSSPDPHL
SQAAKGVIAGCHFQ*

DNA
ATGAAGATCATTTCTTTGACTCTTATTCCATTTTTAATATCCATGGCACCATATCCAATTTTGAGCAAAGCCCCTTTCGG
CACTCCTTCTGCCGGTGGCGGCTCTGTTGGGTTTAACGCCCCTACTGGCCCCGGCTATAGGAGTGGGGATACCGCCCCCG
GCGGCTCTAGTGGGATTAACGGCCCTAATGGCCCCGGCTATAGGAGTGGGGGTCCCGGCGGCTATAAGAGTGGCGATACT
AGCGCTGGCTATAGAAATGGATCTCCACCCGGTAAGCGAGTAGGTGGAGGCGACCCTGGTGCGGCTATCGTTGTGTTCCC
AAAGAAACCTGTACCAACGCCAGTACCAGCAGAATGCAAACCAATTGCAGGATGCGTCACTAAGCATATAGCCGGAGGCA
ACCCCACGGTGCCTCAATACCATGGACCATGTTGTAATCAATTTAAAAACAAAGTATCGTGTGTGTGTAAATTCCTCATG
TCCACGAATGCTAAGCAACAAAGGGCTGCTGATGGTGTGGTTCGAGGTTGTAATTTTAAAAATCCCATTTGTATAAAGAA
GCCAATGCCAGCAGCATGCAGACCAGAAGTTAAGCATTGTGTCGAAATGCATATGTACAGAAGAGCTAGCAATCCTACAT
TCGGAAGCCCATGTTGTCAGAAATTTAAAACCTCGAAACGATGTATCATGGCGTTTAAAAGCTCTCCGGATCCTCATTTA
AGCCAAGCAGCTAAGGGTGTTATTGCAGGTTGTCATTTTCAATAA