Details for Chinese cabbage Locus Brara.G03474

Position : A07 ( 5`- 26085775 .. 26087972 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03474

Protein [Map View]
MSGNSLGLLDSSGGGVGGLGEEEKDMKMEETNEVGGGGGGGGGSRWPRPETLALLKIRSEMDKSFRDSTLKAPLWEEISR
KMMELGYKRSSKKCKEKFENVYKYHKRTKEGRTGKSEGKTYRFFEELEAFESQPAKSPAATTTTTATTSLIPWISSNHPS
TEKTPSPLKHQQHQVSVKPIATNPTFLAKQPPPTTPFPFYSNNHATTPDHTGFKPTSNNDLLNNVSSLNLFSSSTSSSTA
SDEEEDQEKRSRKKRKYWKGLFTKLTKELMEKQEKMQKKFLETLENRERERISREEAWKVQEVARINKEHETLVHERSNA
AAKDAAIISFLHKISGGGGQQQQQPQQQPQQNQKLPQRKQYQSEQHSITFESKEPMPVPLDATMKMGNHSLSPSSSRWPK
TEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKRPLDSKTCPYFHQL
EALYNERNKNGALPMLPLMVTPQRQLLLPQETQTEFETDGRDKVGNKEGEEEGESEEDDYEDEEEEGEGDNDTSEFEIVL
NKTSSPMDINNNLFT*

DNA
ATGTCTGGAAACTCTTTAGGACTGTTAGATAGCTCCGGTGGCGGTGTAGGCGGTTTGGGTGAGGAGGAGAAAGATATGAA
GATGGAGGAAACCAACGAAGTAGGCGGTGGAGGAGGAGGAGGAGGAGGAAGCCGGTGGCCAAGACCGGAGACTTTAGCTC
TCTTGAAGATACGTTCGGAGATGGATAAATCCTTTCGTGACTCTACTCTTAAAGCTCCTTTATGGGAAGAAATCTCCAGG
AAAATGATGGAGCTTGGTTACAAGAGAAGTTCAAAGAAGTGCAAGGAGAAGTTCGAGAACGTGTACAAGTACCACAAACG
TACCAAAGAAGGTCGTACGGGTAAATCTGAAGGCAAAACTTACCGGTTCTTCGAAGAGTTAGAAGCTTTCGAGTCGCAAC
CCGCAAAATCTCCTGCAGCGACCACGACCACGACCGCAACCACTTCTTTGATACCGTGGATCAGCTCTAACCATCCATCA
ACCGAAAAGACTCCTTCACCGTTGAAACATCAACAACATCAGGTTAGTGTGAAACCCATCGCTACAAACCCTACCTTCCT
AGCCAAGCAACCGCCTCCAACAACACCTTTCCCCTTTTATAGCAACAACCATGCAACTACACCTGATCATACTGGCTTTA
AACCAACTTCGAATAATGACTTGCTAAACAATGTTTCGTCGCTGAATCTTTTCTCGAGCTCAACTTCTTCATCTACTGCA
TCTGACGAGGAAGAAGATCAAGAAAAGAGATCGAGAAAGAAGAGGAAATACTGGAAAGGATTGTTCACCAAGTTGACAAA
AGAGTTGATGGAGAAACAAGAGAAGATGCAAAAAAAGTTTTTGGAAACTTTGGAGAATCGAGAAAGAGAGAGAATCTCAA
GAGAAGAAGCTTGGAAGGTCCAAGAGGTAGCGAGGATCAATAAAGAACACGAAACACTAGTCCATGAAAGGTCTAATGCC
GCAGCTAAAGACGCTGCGATCATATCCTTCTTACACAAAATCTCTGGAGGAGGAGGACAACAACAACAACAACCACAACA
GCAACCGCAGCAGAATCAAAAATTACCTCAAAGGAAACAATATCAAAGTGAACAACATTCAATAACATTTGAGAGTAAAG
AGCCAATGCCGGTTCCATTAGATGCAACAATGAAGATGGGGAACCATTCGCTATCTCCTAGCTCTTCAAGATGGCCTAAG
ACCGAGGTCGAAGCCCTAATAAGGATAAGGAAGAATCTTGAAGCTAACTATCAAGAAAACGGTACAAAGGGGCCATTATG
GGAGGAGATATCAGCAGGGATGAGGAGATTGGGATACAATAGAAGCGCAAAACGATGCAAAGAGAAGTGGGAAAACATTA
ACAAGTACTTCAAGAAAGTCAAAGAGAGCAACAAGAAACGACCCCTTGATTCCAAGACTTGCCCTTATTTCCACCAGCTT
GAAGCTTTGTACAATGAGAGGAACAAGAATGGAGCATTGCCAATGTTGCCTCTAATGGTGACCCCACAGAGACAGTTGCT
TCTTCCACAAGAAACTCAAACTGAGTTTGAGACTGATGGGAGGGACAAAGTTGGTAACAAAGAAGGTGAGGAGGAAGGAG
AGAGTGAAGAAGATGATTATGAAGATGAAGAAGAAGAAGGAGAAGGAGACAATGATACAAGTGAGTTCGAGATTGTGTTG
AACAAAACATCTTCACCAATGGACATAAACAATAATCTTTTCACCTAA