Details for Chinese cabbage Locus Brara.G03473

Position : A07 ( 5`- 26077848 .. 26080424 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03473

Protein [Map View]
MEFGGGTTTTTSAPAEAPPPPQSNDAAAATEAAAAAATVGAFEVSEEMNDRGGFGGNRWPRQETVALLKIRSDMGIAFRD
ASAKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKYHKRTKEGRTGKSEGKTYRFFDQLEALETHHQPQTQPPPLRPHN
NNSSMFSTPPPVTTTIIPPTTTPSFPNISGDFMSDNSTSSSSSYSTSSDVDIGGGGGRNKKKRKRKWKEFFERLMKQVVD
KQEELQRQFLEAVEKRERERMAREESWRAQEIARINREREILAQERSMSAAKDAAVMAFLQKFSEKPNPQGQSIPQPQPQ
PQPQPQLQMQVNSNNNQQQTSQTPQTPQPPPPPPLPQPTLDTAKTDNGDQIMTTPASASSSRWPKVEIEALIKLRTNLDS
KYLENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKYFKKVKESNKKRPQDSKTCPYFHQLDALYRERNKFQTTTT
NNNVASSSSTKPDNSVPLMVQPEQQWPPAATVSQPDHHPAQPLDQSFDDEEGTDEEDYDDEEEDEENEEEEGEFELVPSN
DNKTNNV*

DNA
ATGGAGTTTGGTGGTGGTACTACTACAACCACATCCGCACCCGCAGAGGCGCCGCCACCGCCACAATCGAACGATGCGGC
CGCCGCCACAGAAGCTGCGGCAGCTGCAGCAACGGTTGGAGCGTTCGAGGTGTCGGAGGAGATGAACGACCGTGGTGGAT
TCGGAGGAAACCGGTGGCCGCGGCAGGAAACGGTTGCGCTGCTCAAAATACGATCTGACATGGGAATAGCGTTTCGAGAC
GCTAGCGCTAAAGGTCCCTTGTGGGAAGAGGTTTCCAGGAAAATGGGGGAACTTGGTTACATAAGAAACGCAAAGAAATG
CAAAGAGAAATTCGAAAACGTTTACAAATACCACAAACGAACCAAAGAAGGTCGTACCGGCAAATCCGAAGGCAAAACTT
ATCGCTTCTTTGATCAGTTAGAAGCTCTCGAGACTCATCACCAACCGCAAACGCAACCGCCACCTCTACGACCTCACAAC
AACAACAGCTCCATGTTCTCCACTCCTCCTCCGGTAACAACAACTATTATCCCCCCGACAACTACACCTTCGTTTCCAAA
CATCTCCGGAGACTTTATGTCGGATAATTCGACGTCTTCTTCGTCTTCTTACTCCACTTCCTCTGACGTGGACATCGGTG
GCGGCGGAGGGAGGAACAAGAAGAAGAGGAAGAGGAAGTGGAAGGAGTTTTTCGAGAGGCTGATGAAACAGGTCGTAGAT
AAGCAAGAGGAGCTTCAAAGACAGTTCTTGGAAGCTGTTGAGAAGCGCGAGCGCGAGAGAATGGCTAGAGAAGAGTCTTG
GAGAGCTCAAGAGATCGCTAGGATCAACCGCGAACGCGAGATCTTGGCTCAAGAACGCTCCATGTCTGCGGCTAAAGACG
CCGCGGTCATGGCCTTTCTCCAGAAGTTTTCGGAGAAACCGAACCCTCAAGGTCAATCAATCCCGCAGCCACAACCGCAG
CCACAACCGCAGCCGCAACTGCAAATGCAGGTTAATAGCAACAACAATCAGCAGCAAACGTCCCAAACGCCTCAAACGCC
CCAACCACCACCACCACCTCCGCTTCCGCAGCCAACCTTAGACACTGCAAAAACAGACAATGGCGATCAGATCATGACAA
CTCCGGCGTCTGCTTCCTCCTCGCGGTGGCCGAAAGTGGAGATAGAAGCGTTGATAAAGCTGAGGACGAATCTCGATTCG
AAGTATCTAGAGAACGGACCAAAAGGACCATTGTGGGAAGAGATATCAGCGGGGATGAGGAGGTTAGGATTCAACAGGAA
CTCAAAGAGATGCAAAGAGAAGTGGGAAAACATAAACAAATACTTCAAGAAAGTGAAGGAGAGCAACAAGAAGCGCCCTC
AAGACTCCAAGACTTGTCCTTACTTCCACCAGCTTGATGCTTTATATAGAGAGAGGAACAAGTTCCAAACCACCACCACC
AACAACAATGTAGCTTCTTCTTCCTCAACTAAACCGGATAATTCGGTTCCCTTGATGGTCCAACCGGAGCAGCAATGGCC
TCCTGCTGCAACGGTGTCTCAACCTGATCATCATCCTGCTCAGCCGTTGGATCAGAGCTTTGATGATGAAGAAGGCACAG
ATGAAGAAGACTATGATGATGAGGAAGAGGACGAGGAGAATGAAGAAGAAGAAGGTGAGTTTGAGCTAGTGCCGAGCAAT
GATAACAAGACGAATAATGTGTGA