Details for Chinese cabbage Locus Brara.G03472

Position : A07 ( 5`- 26065410 .. 26066516 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03472

Protein [Map View]
MSGEEDATVREPLDLIRLSLDERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTVEIDDETYEEIVRTIKRNIQYL
FVRGDGVILVSPPLRTT*

DNA
ATGTCCGGCGAGGAAGACGCCACCGTGAGGGAGCCACTAGATCTGATTCGTCTGAGTCTCGACGAGAGAATCTATGTCAA
GCTCCGCTCTGACCGCGAACTCCGCGGCAAGCTTCACGCGTTTGATCAGCATTTGAACATGATTCTGGGTGATGTTGAAG
AAGTTATCACAACTGTAGAAATCGATGACGAGACCTACGAAGAGATTGTCAGGACGATAAAGCGCAATATTCAGTATCTG
TTTGTGAGAGGAGATGGAGTGATATTGGTGTCTCCACCTTTGAGGACAACCTGA