Details for Chinese cabbage Locus Brara.G03468

Position : A07 ( 5`- 26044205 .. 26045572 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03468

Protein [Map View]
MAATSLSPSTILSLNRKGSSTVPALAPRSISAVKFQFPLRRIRTGDLNLSSLSSSTRSTPRPIEAKKQTYNSFDDLLVNS
EKPVLVDFYATWCGPCQFMVPILSEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTLILFKDGEPCDRFEGALAANQL
VQWIEDSLEVKT*

DNA
ATGGCGGCTACTTCTCTCTCACCATCTACAATCCTATCTCTGAATAGGAAAGGCTCGTCTACTGTTCCTGCTCTCGCTCC
GCGCTCTATCTCCGCCGTCAAATTCCAGTTCCCACTTCGCCGGATTCGAACCGGAGACTTAAACCTTTCCTCGCTATCTT
CATCAACTCGATCCACTCCTCGCCCTATTGAAGCAAAGAAGCAGACATATAACTCGTTTGATGATCTCCTTGTGAACTCT
GAGAAGCCTGTTCTTGTCGACTTCTACGCGACCTGGTGTGGCCCTTGTCAGTTCATGGTTCCGATTCTCAGTGAAGTGAG
TGAAACATTGAAAGACAAGATCCAGGTGGTGAAGATTGATACGGAGAAGTATCCGAGTATTGCTAATAAATACAAGATCG
AGGCGCTTCCTACGCTTATCTTATTCAAAGATGGGGAGCCTTGTGACCGATTTGAGGGTGCTTTGGCGGCGAATCAACTT
GTTCAATGGATTGAAGATTCTCTTGAAGTGAAGACTTAG