Details for Chinese cabbage Locus Brara.G03465

Position : A07 ( 5`- 26023700 .. 26024720 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03465

Protein [Map View]
MGAGVKDAYIISLNASEAIDATKKGSLARFINHLCKPNCETRKWNVLGEVRVGIFAKESISPRTELAYDYNFEWYGGTKV
RCLCGAVSCSGFLGAKSRGFQEDTYVWEDGDDRYSVDKIPVYDSAEDELTSEPCKNVESNTNEEKDIVKEENKLQTCCVV
RKVMIMIRLL*

DNA
ATGGGTGCAGGTGTAAAGGATGCTTACATAATATCTCTCAATGCCTCTGAGGCTATTGACGCCACTAAGAAAGGAAGCCT
TGCTAGGTTTATAAATCATTTATGTAAACCAAACTGTGAGACGAGGAAGTGGAATGTTCTTGGAGAAGTCAGAGTTGGGA
TCTTTGCCAAAGAGAGCATATCTCCAAGGACTGAGCTGGCTTATGACTATAACTTTGAGTGGTACGGTGGAACCAAAGTC
CGTTGTCTCTGTGGTGCAGTCTCTTGCTCTGGCTTTCTTGGAGCCAAGTCTCGTGGCTTTCAGGAGGATACATATGTATG
GGAGGACGGTGATGATCGGTACTCAGTTGATAAGATTCCGGTCTATGATTCTGCGGAAGACGAGCTTACATCTGAGCCTT
GTAAGAATGTTGAGTCCAACACAAATGAAGAGAAAGATATTGTGAAGGAGGAGAATAAGCTCCAAACCTGCTGTGTGGTT
CGGAAGGTTATGATTATGATTAGACTTTTGTGA