Details for Chinese cabbage Locus Brara.G03464

Position : A07 ( 5`- 26021196 .. 26023593 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03464

Protein [Map View]
MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSDSAQRQAYDAFGKSGISTDAI
IDPAEIFAMLFGSELFERYIGQLAMASMASLDIFTEGENDMFDTKKIQEKMRTVQKEREDKLAQILKDRLNEYVVNRDEF
ITNAEAEMVRLSKAAYGVEMLNTIGYIYVRQASKELGKKALLLGVPFVAEWVRNKGHYIKSQLTAATGAFALFQLQEEMK
KQLNGEVNYTEEELEEYLQSHKRVMVDSLWKLNVADIEATLSRVCQLVLQDPDAKREELRARARGLKTLGKIFQRAKTAS
ESEPIARTEPEKLNEDERDYDDDASTSPKSNEASHSTYGTQEQKSPYVEEPKLGDEQFKHYFPRPAPPPGVEKHTSSTGY
D*

DNA
ATGGTGAAGGAAACAGAGTACTATGATGTGCTGGGCGTTAGCCCAACTGCTACAGAGTCTGAGATCAAGAAAGCTTACTA
CATCAAGGCACGCCAAGTTCATCCAGATAAGAACCCTAATGATCCTCAAGCTGCTCACAACTTCCAGGTGTTGGGAGAAG
CCTATCAAGTGCTAAGTGATTCAGCACAACGGCAAGCTTATGATGCATTTGGGAAGTCTGGGATCTCAACTGATGCAATC
ATAGATCCTGCGGAAATATTCGCAATGCTTTTCGGCAGCGAGCTTTTCGAAAGGTACATTGGACAGCTAGCTATGGCGTC
AATGGCTTCACTCGATATCTTCACTGAAGGGGAAAATGATATGTTTGATACCAAAAAGATTCAAGAGAAAATGAGAACAG
TTCAGAAAGAAAGAGAAGACAAGCTTGCTCAGATTCTCAAAGACCGCCTTAACGAATACGTGGTTAACAGAGACGAGTTT
ATCACCAACGCCGAAGCTGAAATGGTTAGGCTCTCCAAGGCAGCGTATGGTGTGGAGATGTTGAATACAATTGGGTATAT
ATATGTAAGACAAGCATCAAAGGAGCTTGGGAAGAAAGCTCTCCTTCTCGGAGTACCGTTCGTTGCTGAATGGGTTAGGA
ACAAAGGTCACTACATCAAATCCCAACTCACTGCTGCAACAGGCGCATTCGCGTTGTTCCAGCTGCAGGAGGAGATGAAG
AAGCAGCTAAACGGTGAAGTGAATTATACGGAGGAGGAGCTTGAGGAATACCTTCAGTCCCATAAAAGAGTGATGGTTGA
TTCTCTGTGGAAGCTCAACGTTGCTGACATAGAAGCTACTCTCTCCCGTGTTTGTCAGCTGGTTCTTCAAGATCCTGATG
CCAAGAGGGAGGAGCTTCGTGCAAGAGCAAGAGGGCTAAAAACTCTGGGGAAGATCTTCCAGAGAGCGAAGACAGCTAGT
GAGAGTGAACCTATAGCAAGAACTGAACCTGAAAAGCTAAACGAGGACGAAAGGGACTATGATGATGATGCATCTACATC
TCCAAAGTCCAATGAAGCGTCTCACTCTACCTATGGTACTCAGGAACAGAAGAGCCCCTACGTGGAGGAACCGAAGCTAG
GAGATGAACAATTCAAACATTACTTCCCAAGACCCGCACCACCACCTGGCGTGGAGAAACACACTTCATCAACTGGCTAT
GACTGA