Details for Chinese cabbage Locus Brara.G03463

Position : A07 ( 5`- 26017241 .. 26019775 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03463

Protein [Map View]
MEKTESEKKQSSSVSDVGAWGMNIVSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMVSNATGLSASKHIPLW
ELLWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWILHSRHYSREVKASVMVVVVGVGICTVTDVKVNAKG
FICACTAVFSTSLQQISIGSLQKKYSVGSFELLSKTAPIQALSLLIFGPFVDYFLSGKFITTYQMTYGAIFCILLSCALA
VFCNISQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSEMTFKNISGMVVAVVGMVIYSWAVDLEKQRNAKSTPHGKN
SMTEDEIKLLKEGIEHIDLKDVELGETTKV*

DNA
ATGGAGAAAACGGAGAGCGAGAAGAAGCAGTCGTCGTCAGTCTCCGACGTCGGAGCATGGGGGATGAACATCGTCAGCTC
CGTGGGGATCATCATGGCTAATAAACAGCTCATGTCTTCCTCTGGCTTCGGATTCAGCTTCGCGACAACACTAACGGGAT
TCCACTTCGCGCTCACGGCGCTCGTTGGCATGGTGTCGAACGCGACGGGGCTCTCTGCGTCGAAGCACATTCCTCTTTGG
GAGCTTCTTTGGTTCTCTATTGTAGCTAACGTCTCCATCGCTGCTATGAACTTCAGCCTCATGCTCAACTCTGTTGGCTT
CTACCAGATATCGAAGCTGAGTATGATTCCGGTTGTATGCGTGATGGAATGGATACTACATAGCAGGCATTACTCTAGAG
AAGTGAAGGCGTCTGTTATGGTTGTGGTTGTTGGTGTTGGCATCTGTACTGTCACTGATGTCAAGGTTAATGCCAAAGGT
TTCATTTGCGCTTGTACTGCCGTCTTCTCCACTTCCCTGCAGCAGATTTCCATAGGCTCTCTGCAGAAGAAATACTCGGT
AGGGTCTTTTGAGTTGCTGAGCAAAACAGCTCCTATCCAAGCACTTTCACTCCTCATCTTCGGCCCCTTTGTTGACTATT
TCTTGAGCGGCAAGTTCATCACTACTTACCAGATGACTTATGGTGCCATTTTCTGTATTCTTCTTTCCTGCGCTTTAGCC
GTTTTCTGTAACATAAGCCAATACCTCTGCATAGGAAGATTCTCTGCAACGTCATTTCAAGTTCTAGGCCACATGAAAAC
AGTCTGCGTCCTTACGCTTGGATGGCTTCTCTTTGATTCGGAGATGACGTTCAAGAACATCTCCGGTATGGTCGTAGCTG
TTGTCGGGATGGTGATCTATAGCTGGGCGGTTGATCTAGAGAAACAGAGAAACGCAAAGTCGACTCCTCATGGGAAAAAC
AGTATGACAGAAGATGAGATTAAGCTACTCAAGGAAGGAATAGAGCATATCGATTTGAAAGATGTTGAGCTCGGTGAGAC
CACTAAAGTATAG