Details for Chinese cabbage Locus Brara.G03460

Position : A07 ( 5`- 26010146 .. 26010655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03460

Protein [Map View]
MKNTQRQLSSSFMKLYERLSSDINREDKNKDLAAVFAYMDANRDGRISAEELKKSFKTLGEQLSDQEAEAAVKLSDLDGD
GMLDFEEFAQLLKGGDEFTEEEKKSKIMEAFRMYIAEGEDCITPRSLKMMLMKLGESRTTDDCVVMIKAFDLNADGVLSF
DEFALMMMH*

DNA
ATGAAGAACACTCAACGTCAGTTATCTTCATCTTTCATGAAACTCTACGAGAGACTGTCCTCAGACATCAACCGTGAAGA
CAAGAACAAAGACTTGGCGGCTGTCTTTGCATACATGGATGCAAACCGAGACGGTAGAATCTCAGCAGAGGAGCTTAAGA
AGAGTTTCAAGACACTGGGAGAGCAACTATCTGACCAAGAAGCCGAAGCCGCGGTTAAACTCTCTGATTTAGACGGAGAT
GGGATGCTGGATTTTGAGGAGTTTGCTCAGTTACTCAAAGGGGGTGATGAGTTTACAGAGGAAGAGAAGAAGAGCAAGAT
AATGGAAGCGTTTAGAATGTACATTGCTGAGGGAGAAGATTGCATTACTCCAAGAAGCTTGAAGATGATGCTGATGAAGC
TTGGTGAGTCTAGAACCACTGATGATTGTGTAGTCATGATCAAAGCTTTTGATCTCAATGCTGATGGAGTTTTGAGCTTT
GATGAGTTTGCTCTTATGATGATGCATTAA