Details for Chinese cabbage Locus Brara.G03455

Position : A07 ( 5`- 25984338 .. 25985956 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03455

Protein [Map View]
MGPMMRAEEESPPPWLIPLLRANYFVPCSIHADSNKSECNMFCLDCTSSSFCSYCLTNHKNHRVLQIRRSSYHNVVRVNE
IQKYIDISCVQTYIINSARIVFLNERPQPRIGKGVTNTCEICCRSLLDSFRFCSLGCKLGGMKRGNQSLTFSLKGKHGRE
YQAGEDSDEATTPTKIRKTCAFNRLMSGLSISTAKSDYFSGDQWSSSSGDESGFNLSPGTPPIYNHRNSSRRKGVPHRAP
F*

DNA
ATGGGACCAATGATGAGAGCAGAAGAAGAAAGTCCACCACCATGGCTAATCCCATTGCTAAGAGCAAACTACTTCGTCCC
ATGTTCGATCCACGCTGATTCCAACAAAAGCGAATGCAACATGTTCTGTCTTGACTGCACTTCTAGTTCCTTTTGCTCTT
ACTGTTTGACCAATCACAAAAACCATCGTGTCCTTCAGATACGAAGATCATCGTACCACAACGTTGTGAGGGTGAATGAG
ATTCAGAAGTACATAGACATCTCTTGTGTCCAGACATATATAATCAACAGCGCAAGGATCGTGTTCTTGAACGAACGTCC
TCAGCCAAGAATCGGCAAAGGCGTTACCAATACTTGCGAAATATGTTGCAGAAGCCTCCTTGATTCTTTCCGTTTCTGCT
CTCTTGGTTGCAAACTTGGAGGGATGAAAAGAGGAAATCAAAGTCTAACCTTCTCTTTGAAAGGGAAGCATGGGAGGGAG
TATCAAGCTGGGGAGGACTCTGATGAGGCGACCACACCAACTAAGATACGCAAGACATGTGCTTTCAACCGTCTGATGAG
TGGTCTCTCCATCTCCACCGCTAAATCAGATTACTTTTCAGGAGATCAATGGTCTTCAAGCTCCGGTGATGAAAGCGGTT
TTAATCTTTCTCCGGGGACACCACCTATCTATAATCACCGGAACTCAAGCAGACGGAAGGGCGTACCACACCGTGCTCCG
TTCTGA