Details for Chinese cabbage Locus Brara.G03454

Position : A07 ( 5`- 25977824 .. 25982110 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03454

Protein [Map View]
MDEVGPQVAGPVSIHHSIGRKRDLYYQMSNRQPYWLVPPQPQQNDWNPKMWEWDSQRFEAKPVEAEVGNCSTQFDLNARS
NSEDDNNNNNNGGLSYEGEERRGLDLNLSSGVMEETTRPNKKVKSGSPGRNYPKCQVDNCNEDLSVAKDYHRRHKVCEVH
SKATKALVGNQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTQPEEVTSGGAVAASDKNKANMDVMALLTALA
CAQGRNGSQSNGSPAVPQREQLLQILNKINALPLPVDLVSKLNSIGVLARKNLDQPTNSRNDVNGGDSSPSTMDLLAVLS
STLGSSAPEAIAFLSKGGFDNKESNDKTKLTSPEKRTLEFPPFVGGERTSSSNNPSPSQETRSSSLSLQLFTSSPEDERQ
QPTVASSGKYYSSASSNPVEDRSPSSSPVMQELFPMQTSPETMRSNNCKNSSPSPRNNCLPLELFGGSNRGAAAAAAAAN
PSYASSGSDYSPPSLNSDSQDRTGKIVFKLLGKDPSQLPGTLRTEISSWLSSIPSEMESYIRPGCVILSVYVAMSASAWE
QLEENLVQRVSALVQDSEFWSSTRFLVNTGRQLASYKHGRIRLSKSWRTLSSPELITVSPVAVVAGEETTLVVRGRSLTN
DGISFRCAHMGNYTSMEVTGTAHRSTKFDELNVNKFKVKGPSSGSLGRCFVEVENGFRSDSFPLIIANATICKELNRLED
CPSSREEVLCFLNELGWLFQKKCRSESDFSLPRFKFLLVCSVERDYSSLVRTILDMMVERDGVMSKESLDMLAESQLLSR
AVKRKNTKMAETLIHYSAKRFIFLPSVKGPGGITPLHLAASTSGSEDMIDVLTNDPQEIGLSSWNTLVDASGQTPFSYAA
MRNNHGYNTLVSRKLADKRNGQISLNIENGIDQIGVSKRLSTELKRSCNTCASVALKYQKKVSGTRRLFPTRIIHSMVAV
ATVCVCVCVFMHAFPIVRQGSHFSWGGLDYGSV*

DNA
ATGGATGAGGTGGGTCCTCAAGTGGCTGGTCCGGTCTCAATTCACCATTCCATAGGGAGAAAACGAGATCTTTATTACCA
GATGTCGAATCGTCAGCCCTACTGGCTTGTCCCGCCTCAGCCACAACAGAATGATTGGAACCCTAAGATGTGGGAATGGG
ACAGTCAGAGATTCGAAGCTAAACCTGTTGAGGCAGAAGTTGGGAACTGCAGCACGCAGTTTGATCTCAATGCGAGGAGT
AACAGTGAAGATGATAACAACAACAACAACAACGGTGGTTTGAGTTACGAGGGAGAAGAAAGAAGAGGTCTTGATTTGAA
TCTGAGCAGCGGTGTTATGGAAGAGACCACGAGACCTAACAAGAAGGTTAAGTCTGGATCTCCGGGGAGGAACTACCCCA
AGTGCCAGGTCGATAACTGTAACGAAGATCTATCAGTTGCAAAGGACTATCACAGAAGACATAAGGTCTGTGAGGTTCAC
AGTAAAGCTACTAAAGCTCTTGTTGGGAATCAGATGCAGAGGTTTTGCCAACAGTGTAGCAGGTTTCATCTTCTTTCGGA
GTTTGATGAGGGGAAGAGAAGCTGCAGGCGGAGGTTAGCTGGACATAACAGGAGGAGAAGGAAAACTCAGCCGGAGGAGG
TTACATCTGGTGGGGCTGTAGCAGCTTCTGATAAAAACAAAGCTAATATGGATGTTATGGCTTTGTTAACAGCTTTGGCT
TGTGCACAAGGTAGGAACGGTTCTCAATCCAATGGCTCTCCAGCAGTCCCGCAAAGAGAGCAGCTTCTTCAGATACTCAA
CAAGATCAATGCGTTGCCTCTCCCTGTGGATCTTGTCTCTAAGTTGAACAGTATCGGAGTTTTAGCTAGGAAAAATCTGG
ATCAACCAACGAACTCACGAAATGATGTGAATGGGGGGGACTCTTCTCCTTCTACAATGGACTTGCTTGCTGTTCTCTCT
TCCACTTTAGGCTCGTCTGCACCTGAGGCCATCGCTTTCTTATCTAAAGGAGGGTTTGATAACAAGGAGAGCAATGATAA
GACTAAGCTAACTTCACCTGAAAAGAGAACGTTGGAGTTTCCTCCCTTTGTGGGAGGTGAGAGAACAAGCAGCAGCAACA
ACCCGTCTCCTTCTCAGGAGACTAGATCTTCTAGCTTGTCTCTACAGCTATTCACCTCTTCTCCAGAGGATGAGAGGCAA
CAACCAACGGTTGCATCTTCAGGGAAGTACTATTCCTCTGCGAGCAGCAACCCGGTGGAAGATAGATCTCCATCATCGTC
TCCGGTCATGCAGGAGTTGTTCCCAATGCAGACGTCTCCTGAAACCATGAGATCTAACAATTGCAAAAACTCTAGTCCTA
GTCCGAGGAATAATTGTTTGCCTTTAGAGCTTTTTGGTGGATCTAATAGAGGAGCTGCTGCTGCTGCTGCAGCTGCAAAT
CCTAGTTATGCTTCGTCTGGTTCGGATTATTCACCTCCCAGCTTAAACTCTGATTCTCAGGACCGCACTGGGAAGATAGT
TTTCAAACTGCTTGGGAAAGATCCTAGTCAGCTCCCTGGGACATTGAGAACCGAGATCTCTAGCTGGCTTTCTAGCATTC
CATCAGAAATGGAGAGTTACATCAGGCCTGGCTGTGTTATTCTATCTGTCTATGTGGCAATGTCAGCTTCTGCTTGGGAA
CAACTTGAGGAAAACTTGGTGCAGCGAGTTAGTGCTTTGGTTCAAGATTCAGAGTTTTGGAGCAGCACAAGGTTTTTAGT
CAACACAGGGAGACAGCTCGCGTCTTACAAACATGGTAGAATTCGTCTGAGCAAATCTTGGAGAACGTTGAGTTCACCAG
AGCTGATCACGGTGTCACCTGTTGCTGTTGTAGCCGGTGAAGAAACTACTTTGGTAGTAAGAGGAAGAAGCTTGACTAAT
GATGGAATTAGTTTCCGTTGTGCCCATATGGGTAACTATACATCAATGGAAGTAACCGGAACGGCGCATAGAAGCACTAA
ATTTGATGAGTTAAATGTAAATAAGTTCAAAGTTAAAGGTCCAAGCAGTGGTTCTCTAGGGCGCTGTTTTGTTGAGGTGG
AGAACGGATTCAGAAGCGACAGTTTCCCTTTGATTATCGCCAACGCCACCATTTGCAAAGAGCTGAATCGCCTTGAAGAT
TGTCCAAGTTCAAGAGAAGAAGTTCTTTGTTTCTTGAACGAGCTCGGTTGGCTGTTTCAGAAGAAATGTAGATCCGAATC
CGACTTCTCCCTCCCTCGCTTCAAGTTTCTGCTCGTGTGCTCTGTCGAAAGAGACTACTCTTCTCTCGTGAGAACCATCC
TGGATATGATGGTAGAGAGGGACGGTGTGATGAGCAAAGAGTCTTTAGATATGTTGGCCGAGTCTCAGCTCCTGAGCCGC
GCTGTTAAAAGGAAGAACACAAAGATGGCGGAGACGCTGATTCATTATAGTGCTAAAAGGTTTATCTTCTTGCCTAGCGT
CAAGGGACCTGGTGGTATCACGCCTCTGCATCTGGCTGCTTCTACTTCTGGCTCGGAGGATATGATTGATGTCTTGACTA
ATGATCCACAAGAGATTGGATTGTCCTCTTGGAATACCTTAGTAGATGCAAGTGGTCAGACTCCGTTTAGCTACGCTGCC
ATGAGGAACAACCACGGTTACAACACCTTGGTGTCTCGCAAGCTTGCAGACAAGAGAAACGGTCAGATATCTTTAAACAT
CGAGAACGGGATCGACCAGATCGGTGTGAGCAAGAGGCTAAGCACAGAGCTCAAGAGATCTTGCAACACTTGTGCTAGTG
TAGCTCTAAAGTATCAGAAGAAAGTCTCAGGCACACGGCGCTTGTTTCCAACTCGGATCATTCACTCAATGGTTGCTGTT
GCTACGGTCTGTGTCTGCGTTTGCGTGTTTATGCATGCTTTCCCTATCGTCAGACAAGGGTCACACTTCAGCTGGGGAGG
TCTTGATTATGGCTCAGTCTAA