Details for Chinese cabbage Locus Brara.G03447

Position : A07 ( 5`- 25940330 .. 25942725 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03447

Protein [Map View]
MDIRRRPPKPPVNPNRFLDNRSPPPPPSSDDDIDRNRSPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTP
LHVVTITELGAIVALIASFIYLLGFFGIDFVQSFISRADSNDSDRDYLVNDDHHRLVTCPPPIVAKLPNPEPPLPEEDEE
IVKSVLDGVVPSYALESRLGDCKRAASIRREALQRLTGRSIEGLPLDGFDYDSILGQCCEMPVGYVQIPVGIAGPLLLDG
YEYSVPMATTEGCLVASTNRGCKAMYVSGGATSTVLKDGMTRAPVVRFASARRASELKFFLESPENFETLAVVFNRSSRF
ARLQSVMCTLAGKNAYVRFSCSTGDAMGMNMVSKGVQNVLEFLTEDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC
EAVIRGETVNKVLKTSVASLVELNMLKNLTGSAIAGSLGGFNAHASNIVSAVFLATGQDPAQNVESSQCITMMEAINDGK
DIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKEAPGMNSRRLATIVAGAVLAGELSLMSAIAAGQLVKSHMKY
NRSSRDITGATTTTTT*

DNA
ATGGATATCCGACGGAGACCTCCTAAACCGCCGGTTAACCCCAACCGGTTCCTCGATAACCGCTCTCCTCCTCCTCCTCC
TTCCTCCGATGACGACATCGATCGCAACCGTTCTCCGAAAGCCTCCGACGCGCTCCCGCTCCCTCTGTACCTCACGAACG
CCGTCTTCTTCACCCTCTTCTTCTCCGTCGCCTACTACCTCCTCCACCGCTGGCGCGACAAGATCCGCTACAACACCCCT
CTCCACGTCGTCACCATCACCGAGCTCGGCGCCATCGTCGCCCTCATCGCCTCCTTCATCTACCTCCTCGGCTTCTTCGG
CATCGATTTCGTCCAGTCCTTCATCTCACGCGCCGACTCCAACGACTCCGATCGAGATTACCTCGTCAACGACGACCACC
ACCGCCTCGTCACGTGCCCCCCTCCGATCGTCGCCAAGCTGCCGAATCCGGAGCCTCCTCTCCCGGAGGAAGACGAGGAG
ATCGTGAAATCGGTGCTCGACGGGGTCGTCCCTTCGTACGCGCTCGAATCTCGCCTCGGGGATTGCAAACGCGCGGCGTC
GATAAGGAGAGAGGCGCTGCAGAGGCTGACCGGGAGGTCGATTGAAGGATTGCCGTTGGATGGATTCGATTACGATTCGA
TCTTGGGGCAATGCTGCGAGATGCCTGTGGGATACGTGCAGATCCCCGTGGGGATCGCTGGACCGTTGCTGCTCGACGGT
TACGAGTACTCTGTTCCCATGGCGACGACGGAAGGGTGTTTGGTGGCGAGTACTAATAGAGGGTGTAAGGCTATGTACGT
CTCCGGTGGTGCGACGAGTACTGTGCTGAAGGATGGGATGACGAGAGCGCCTGTTGTGAGGTTTGCGTCGGCGAGGAGAG
CTTCTGAGCTTAAGTTTTTCTTGGAGAGTCCTGAGAACTTTGAGACTCTGGCTGTTGTTTTCAACAGGTCGAGTAGATTT
GCGAGGCTGCAGAGTGTTATGTGCACGCTCGCTGGGAAGAATGCTTATGTGAGGTTCAGTTGTAGTACTGGTGATGCTAT
GGGGATGAACATGGTATCCAAAGGTGTTCAGAATGTTCTTGAGTTTCTTACTGAAGATTTTCCTGATATGGATGTTATTG
GAATCTCTGGTAACTTTTGTTCGGACAAGAAGCCTGCTGCTGTGAACTGGATCGAGGGACGTGGCAAATCAGTTGTGTGC
GAGGCGGTGATCAGAGGAGAGACCGTGAACAAGGTGTTGAAGACGAGTGTGGCTTCTTTGGTGGAGCTCAATATGCTCAA
GAACCTCACGGGATCTGCTATTGCAGGGTCTCTAGGTGGATTCAACGCTCACGCTAGCAACATTGTTTCTGCTGTGTTCT
TAGCGACTGGGCAAGATCCAGCTCAAAACGTGGAGAGCTCTCAGTGTATCACAATGATGGAGGCCATTAACGACGGGAAA
GATATTCATATCTCTGTCACCATGCCGTCTATTGAGGTGGGGACAGTGGGAGGAGGAACACAGCTTGCGTCTCAATCGGC
TTGTTTGAACTTGCTCGGAGTTAAAGGAGCGAGCAAGGAGGCGCCGGGGATGAACTCAAGGAGGCTAGCGACGATAGTGG
CGGGAGCAGTTTTGGCGGGAGAGTTATCACTAATGTCAGCAATAGCAGCTGGACAACTTGTGAAGAGTCACATGAAATAC
AATAGATCCAGCAGAGACATCACTGGAGCAACGACGACGACAACAACATGA