Details for Chinese cabbage Locus Brara.G03446

Position : A07 ( 5`- 25935490 .. 25937385 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03446

Protein [Map View]
MAEKQRICVTGSGGYIASWLVKSLLSRGYTVHGTVRDPSDRKNNHLKKLDNASKNLKLFKADLFDYEGLSSAISGCYGVF
HIAGPVPFEDVPLTEEQLIKPALTGTKNVLEACTEAKVKKVVVVSSIAAVVYNPKWPRDVDVDESCWSDTQYLYSREGYW
SYYFLAKTLMEREAIEWSRTSSADVVTVCPSVVIGPRLQSTLNSSSLGLLNFIKGGVISLLSDQLYLVDVRDVADALLLV
YENQEAKGRYICNSHSLHNNDLMEKLMNMYPKRKFPKSFSERKEKQVNENILRISSEKLEKLGWKFRSLEETIDDSVVSF
EATGDLPKQ*

DNA
ATGGCTGAAAAGCAGAGGATATGTGTTACTGGTTCAGGAGGATATATCGCTTCGTGGCTCGTCAAGTCTCTTCTCTCCCG
TGGCTACACTGTCCATGGAACTGTTCGAGATCCTAGTGATCGAAAGAACAACCATTTGAAGAAGTTAGATAACGCTTCAA
AGAATCTTAAGCTTTTCAAGGCAGATTTGTTTGACTATGAAGGTCTTTCTTCAGCCATTTCTGGTTGTTATGGTGTTTTC
CATATTGCTGGTCCTGTGCCTTTTGAAGATGTTCCTCTTACTGAGGAACAACTTATTAAACCAGCTCTCACTGGCACCAA
AAATGTTCTAGAAGCGTGCACAGAAGCTAAAGTGAAGAAAGTTGTGGTTGTATCATCAATTGCTGCTGTTGTTTACAACC
CAAAGTGGCCTAGAGATGTTGATGTGGACGAGAGTTGTTGGTCAGACACTCAATACCTTTATTCACGTGAGGGTTATTGG
TCATATTACTTTCTTGCCAAAACCTTAATGGAACGTGAAGCTATAGAGTGGAGCAGAACAAGCTCAGCTGATGTTGTTAC
GGTCTGTCCCTCGGTCGTGATAGGCCCTAGGCTTCAGTCCACGCTTAACTCTAGTAGCTTGGGACTACTAAATTTTATAA
AAGGCGGTGTAATATCCTTGTTGAGTGACCAACTCTACCTTGTGGATGTGCGTGATGTCGCTGATGCGCTTTTGCTGGTG
TATGAAAATCAAGAAGCAAAAGGAAGATACATATGCAACTCTCATTCACTTCACAACAATGATCTTATGGAGAAGCTGAT
GAATATGTATCCTAAACGCAAATTCCCCAAAAGTTTCAGTGAGAGAAAGGAAAAGCAAGTGAATGAGAACATACTTCGAA
TAAGTTCAGAGAAGTTGGAGAAACTGGGGTGGAAGTTTAGGTCATTAGAAGAAACCATTGATGACTCTGTTGTGAGCTTT
GAAGCTACTGGTGATCTTCCAAAGCAATAA