Details for Chinese cabbage Locus Brara.G03444

Position : A07 ( 5`- 25931033 .. 25932564 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03444

Protein [Map View]
MAAITPWLSSPQSFSNPRVSTRYSSRRCTSLPALVTSQEHHQILSRDQVGMKRREVMLQLASSAFFLPFIVSPAFAETSI
VASEAFRVYTDEANKFEISIPQDWQVGQAAEPNGFKSITAFYPEETSSYNVSVAITGLGPDFTRMESFGKVEAFAETLVS
GLDRSWQKPAGVTAKLVDSRSSKGFYYIEYTLQNPGEARKHLYSAIGMATNGWYNRLYTVTGQFTDEESADQSSKIQKAV
KSFKFI*

DNA
ATGGCAGCGATTACTCCATGGCTTTCTTCTCCGCAGAGCTTCTCGAATCCCCGCGTTTCCACTCGCTACAGTTCAAGAAG
ATGCACATCACTTCCTGCTCTCGTCACTTCTCAGGAACACCATCAGATTCTGTCTAGAGATCAAGTTGGGATGAAGAGAA
GGGAAGTCATGTTACAGCTAGCTTCCTCTGCTTTCTTCCTTCCTTTCATCGTTTCACCTGCATTTGCAGAGACAAGTATT
GTTGCTTCAGAGGCTTTCCGTGTGTACACAGATGAAGCAAACAAGTTCGAGATATCAATCCCACAAGACTGGCAAGTAGG
ACAAGCAGCAGAACCTAACGGGTTCAAGTCTATCACAGCTTTCTACCCTGAAGAAACTTCATCATACAACGTGAGTGTAG
CGATCACTGGACTAGGTCCAGACTTCACTAGGATGGAGTCTTTTGGAAAGGTGGAAGCTTTCGCCGAAACACTGGTCAGT
GGATTGGATAGAAGCTGGCAGAAACCAGCAGGAGTTACTGCAAAGCTAGTTGATAGCAGATCTTCCAAAGGATTCTATTA
CATCGAGTATACCTTACAAAACCCTGGAGAAGCTCGTAAGCATCTGTACTCTGCAATTGGGATGGCAACAAACGGTTGGT
ACAACCGTTTATACACTGTCACTGGACAATTTACAGATGAAGAATCTGCTGATCAAAGCTCCAAGATCCAGAAGGCAGTC
AAGTCTTTCAAATTCATCTAA