Details for Chinese cabbage Locus Brara.G03438

Position : A07 ( 5`- 25901143 .. 25905646 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03438

Protein [Map View]
MMLAVEDVLSELAGEERNDRGLPPGFRFHPTDEELITFYLASKVFHGGLCGIHIAEVDLNRCEPWELPEMAKMGEREWYF
YSLRDRKYPTGLRTNRATTAGYWKATGKDKEVFAGGGGGGGALVGMKKTLVFYKGRAPRGLKTKWVMHEYRLETDLSHRH
TCKEEWVICRVFNKTGDRKNVGIHNQISYLHNTSLSTTHQQHNHYHHLEILPPLLEPSKTLTNFPSLLYDDTHQNYNNNL
LHGSSAHNVDEFKTLINPAVSQLNGVIFSPENSNYNNEDDNNFGVKTEQYSNGGNNDLDVRDYLDNPFCQEAGYGLLGLS
SSPGPLMLLDSPYVL*

DNA
ATGATGCTTGCGGTGGAAGATGTGTTGAGTGAGCTCGCCGGAGAAGAAAGAAACGACAGAGGTTTACCACCTGGCTTCCG
GTTTCACCCGACGGACGAAGAGCTCATAACTTTCTACTTAGCCTCTAAAGTCTTCCATGGAGGTCTATGTGGCATTCACA
TTGCCGAAGTTGACCTCAATCGCTGCGAACCCTGGGAACTCCCTGAAATGGCCAAGATGGGAGAGAGAGAGTGGTACTTT
TACAGTCTAAGGGATAGAAAATATCCCACAGGGCTAAGGACTAACAGAGCCACTACCGCTGGATACTGGAAGGCTACCGG
AAAAGATAAGGAGGTCTTTGCCGGCGGTGGCGGCGGTGGAGGAGCACTTGTCGGAATGAAGAAGACCCTTGTGTTCTACA
AGGGTAGGGCTCCACGAGGCCTCAAGACTAAGTGGGTCATGCATGAGTATCGCCTCGAAACTGACCTTTCTCACCGCCAC
ACGTGTAAGGAGGAATGGGTGATTTGCAGAGTGTTTAACAAAACAGGAGACAGAAAGAATGTTGGAATCCATAACCAAAT
CAGCTACCTCCATAACACTTCACTATCAACAACACATCAACAACATAACCATTATCATCATCTTGAAATCTTGCCTCCTC
TTCTTGAACCATCTAAAACCCTAACCAACTTTCCATCGCTACTCTACGATGATACCCACCAAAATTACAATAATAACCTA
CTCCATGGATCATCAGCCCACAACGTTGACGAGTTCAAAACCCTAATCAACCCAGCCGTGTCTCAGCTCAACGGAGTCAT
TTTCTCTCCAGAAAACAGCAACTACAACAACGAGGACGACAACAACTTTGGCGTTAAGACAGAGCAATATTCGAACGGTG
GCAATAACGATCTTGATGTGCGAGACTACTTAGACAACCCTTTCTGCCAGGAAGCGGGTTACGGTCTGTTGGGTCTTTCA
TCTTCTCCTGGACCTCTTATGCTATTAGATTCTCCATATGTCCTTTAG