Details for Chinese cabbage Locus Brara.G03436

Position : A07 ( 5`- 25888098 .. 25889831 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03436

Protein [Map View]
METSLRYTCNSKSLKIHAKEKLPVNSKTHLQLHGELDTGTGAPSYFCAMIRHLFPEAATGLGVGIHYDKRQKLRCHVRGK
KQFPVRDDKSVTFNVKGRCDFDQDFNQRNPIGAAEFAWNIMNFKEDQDVRIKVGYEMFDKVPYMQIRENNWTLNANMKGK
WNLRFDL*

DNA
ATGGAGACTTCTCTGAGGTATACGTGCAATTCAAAGTCGTTGAAAATCCATGCGAAGGAGAAGCTCCCGGTGAACTCGAA
AACCCATTTGCAGCTTCATGGAGAGCTAGATACTGGAACTGGAGCTCCTAGTTACTTCTGTGCGATGATTAGACACTTAT
TCCCCGAGGCTGCAACAGGCCTGGGAGTAGGAATCCATTATGATAAGCGCCAAAAGCTTCGGTGTCACGTACGCGGGAAA
AAACAGTTTCCTGTCAGAGATGATAAGAGTGTCACCTTCAATGTCAAAGGCCGGTGTGATTTTGATCAAGACTTCAACCA
GAGGAACCCTATAGGAGCTGCAGAGTTTGCCTGGAACATAATGAACTTTAAGGAAGATCAGGATGTAAGGATCAAAGTTG
GCTACGAAATGTTTGATAAGGTTCCTTATATGCAGATTAGAGAAAACAACTGGACCCTTAACGCCAACATGAAGGGGAAA
TGGAACTTGAGGTTCGACCTGTAA