Details for Chinese cabbage Locus Brara.G03434

Position : A07 ( 5`- 25881010 .. 25884862 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03434

Protein [Map View]
MAGSCDGSQSDQSSTFEPGIDNIYEAFICPLTKKVMQDPVTLENGQTFEREAIENWFRECTQNGKPVLCPITSKQLSITD
LSPSIALRDTIEEWRARNDCMKLDIARQSLYLGNAEANILLALKNVRDICRNIRLIKRRVRNPQLVRLVTDMLKSTSHEV
RYKALQTLRVVVEGDEESKAIVAEGDTVRTIVKFLAKEPARGREAAVSLLFELSKSELLCEKIGSVHGAILLLVGLTSSK
SENVSTVEKADLTLTNLERSEENVRQMASNGRLQPLLAKLRGGSPETKASMASYLGELALNNDVKVNVAQTVGSCLIDLM
RSRDMRGAALGALNKISSFEGSAKVLIGTGLLPPLIKDLFYVGPNQLPIRLKEVSATILANIVNIGYEFDKVCVGAHHQT
LVSEDVVENLLLLISNTGPEIQGKLLEVLVGLTSCPNSVINVVSAIRNSGAIISLVQFVEVHDNDDLRLAAIKLLHNISP
HMSEELASVLRGTVGQLGNLVGIISESTTTITEDQAVAAALLAELPERDWGLTQRLLGDGAFEKIISKIILIRQGEIRGK
RFERTFLEGLVKILARITFALTKETQAVSFCRENNLASLFLDLLQSYSQDNIQMASAIALENLSLETKNLIVLPELPPPS
YCVSIFSCLSKPPVVLGMCKIHQGICSLRDSFCLVEGQAVDKLVDLLDHENDKVVGPALAALSTLLEDGLEVENAVKLIV
EADGLTPILNVLLENRTENLRIRAVWMVERILRIEDIARELGEEQNVTAALVDAFQNADFKTKQVAENALRHIDKIPNFS
GIFAPTLANK*

DNA
ATGGCTGGAAGTTGTGATGGAAGTCAGTCAGACCAAAGCTCTACGTTCGAGCCAGGGATCGACAACATATACGAAGCATT
CATCTGTCCGTTAACAAAGAAAGTCATGCAAGATCCAGTCACTCTGGAGAACGGTCAGACCTTTGAGCGTGAAGCCATCG
AGAATTGGTTCAGAGAATGTACTCAAAACGGTAAACCTGTGTTATGTCCCATAACTTCTAAGCAGCTTAGCATCACTGAT
CTAAGCCCAAGCATAGCTTTACGCGACACTATCGAAGAGTGGAGAGCTAGGAATGATTGTATGAAGCTTGACATTGCTCG
TCAGTCGCTATATCTAGGTAACGCCGAGGCGAATATTTTGCTGGCGTTGAAGAATGTCAGAGACATCTGCAGGAACATAC
GTTTGATTAAACGCCGTGTCCGCAACCCTCAGCTTGTAAGGTTGGTTACGGACATGCTGAAAAGTACTAGTCATGAAGTG
AGGTATAAGGCTTTGCAGACGCTGCGAGTTGTCGTCGAGGGAGATGAAGAGAGTAAGGCGATTGTGGCTGAGGGAGACAC
TGTGCGTACTATAGTTAAGTTTTTGGCGAAAGAGCCGGCAAGGGGAAGGGAGGCAGCTGTTTCTTTGTTGTTTGAGTTGT
CTAAATCAGAGCTCTTGTGTGAGAAGATTGGTTCGGTTCATGGAGCTATCCTCTTGTTGGTTGGTTTGACGAGCAGCAAG
TCGGAGAATGTTTCAACTGTTGAGAAAGCTGATTTGACTTTGACGAACTTGGAGAGATCAGAGGAAAATGTTAGACAGAT
GGCTAGCAATGGTAGACTCCAGCCTCTTCTAGCTAAACTTCGTGGAGGTTCACCTGAGACAAAAGCCTCCATGGCTTCTT
ATCTTGGAGAGCTTGCTTTAAACAACGATGTGAAAGTTAATGTGGCGCAGACCGTTGGTTCTTGTCTTATCGATCTCATG
AGAAGCCGTGACATGCGTGGAGCTGCATTGGGAGCTCTCAACAAGATCTCATCTTTTGAAGGGAGTGCTAAAGTCTTGAT
CGGCACAGGACTTCTCCCGCCGCTTATCAAAGACCTGTTCTACGTTGGGCCGAACCAGCTTCCCATCCGACTTAAAGAAG
TCTCAGCTACTATTCTTGCCAATATAGTGAACATTGGCTATGAGTTTGACAAAGTCTGTGTTGGAGCTCATCACCAAACT
CTTGTTTCGGAGGACGTAGTTGAGAACCTACTCTTGTTAATTAGCAACACTGGTCCGGAGATCCAGGGGAAGCTCTTGGA
GGTTCTTGTTGGACTAACTAGCTGCCCTAACTCGGTTATAAACGTTGTCTCCGCCATCAGAAACTCAGGTGCTATTATTA
GCTTGGTTCAGTTCGTTGAGGTTCATGATAATGATGATTTGCGTTTGGCTGCTATCAAGCTCCTTCATAACATTTCACCG
CACATGAGCGAAGAGCTAGCTAGTGTGTTGCGCGGCACTGTTGGACAGCTTGGGAACCTTGTTGGGATCATATCCGAAAG
CACAACAACAATCACTGAGGACCAAGCTGTTGCTGCTGCGCTCTTAGCTGAGCTTCCTGAGAGAGATTGGGGTCTGACGC
AGAGATTGCTAGGAGACGGCGCTTTTGAGAAAATCATCTCCAAGATTATTCTTATTCGCCAAGGTGAGATCAGAGGGAAG
CGGTTTGAGAGAACGTTTCTCGAAGGACTTGTTAAAATACTTGCTCGGATCACCTTTGCACTCACCAAGGAGACTCAGGC
CGTTTCGTTCTGCCGTGAAAACAATCTCGCTTCTCTGTTCCTCGATCTCCTCCAGTCATACAGTCAAGATAACATCCAGA
TGGCTTCTGCGATAGCTTTGGAGAATCTTTCACTTGAAACCAAGAATCTGATAGTGTTACCGGAACTGCCTCCTCCAAGC
TACTGTGTCTCCATCTTTTCATGTCTGAGCAAACCGCCTGTTGTTCTAGGGATGTGTAAGATCCATCAAGGGATATGTTC
GCTGAGAGACAGCTTTTGTCTTGTTGAAGGACAAGCGGTGGATAAACTGGTTGATCTTTTGGACCATGAGAACGACAAGG
TGGTTGGGCCAGCACTTGCAGCTCTCTCGACGTTGCTAGAAGACGGTTTGGAAGTAGAAAACGCGGTGAAGTTGATCGTT
GAAGCAGACGGGTTGACGCCTATATTGAACGTTTTGTTGGAGAACAGGACAGAGAATTTGAGGATTCGAGCTGTGTGGAT
GGTTGAGAGGATCTTACGTATTGAAGATATAGCTAGAGAGCTTGGAGAAGAACAGAACGTGACTGCAGCACTTGTTGATG
CATTTCAAAACGCTGATTTTAAAACGAAACAGGTCGCTGAGAACGCGTTGAGACACATCGATAAGATCCCAAACTTCTCT
GGTATATTTGCACCAACATTGGCTAATAAGTGA