Details for Chinese cabbage Locus Brara.G03433

Position : A07 ( 5`- 25877080 .. 25880701 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03433

Protein [Map View]
MGEVADTLTKKRKKKGRPSLIEVQKRALKQQQLLQSKLDESKEEVRSGFGNPNSAATRSSRRIVNPSEEEEEEDDDERRD
KKQRLLHGLNSHDDRRESELDGDASSINRRKIGGAGSDVTGQKGSKATDILQRVSLVESGPVTPLPDKKLLLFILDRVQK
KDTYGVYSDPVDPEELPDYHELIKNPMDFTTLREKLEAGAYSTLEQFEEDVFLICTNAMEYNSSDTIYHRQARAMLELAK
KDFADLRQESDGEVEPVSQSQQLPKVVKRGRPPGSGLKKHSEPFLTDRTISESSADAAAAHTPGGDGSRLTGAYNLRRTP
PSVRTNHYSENQSGLLIDWEKEFPPSVVKAVNKYGMKNVDENRRDSYFLDISPSSQEASVCTSLEDGLKQLTPVGLNTEY
GYARSLARYAANLGPVAWRLASKRIETVLPSGTEFGPGWVGEKPEAPQQQKCSNDLASESIHSSKESKESASAARLLNQK
TVKSEPLINPESNGLLRGCRGVNQMLETAAFSRQGLSPNTKPELNRFHPDLNAKLVSPNSPVSNLQAGSSQQHPDLALQL
*

DNA
ATGGGGGAGGTAGCTGATACATTGACGAAGAAGAGGAAGAAGAAAGGGAGACCATCTCTAATTGAAGTCCAGAAGCGAGC
TCTGAAGCAGCAACAACTGCTTCAGAGCAAGCTAGATGAGTCCAAGGAAGAGGTTAGATCCGGTTTCGGAAACCCTAATT
CCGCCGCAACCCGATCCAGTCGCCGGATTGTTAATCCCAGCGAAGAGGAAGAAGAAGAAGACGATGACGAGCGGAGAGAT
AAGAAGCAACGGCTTTTGCACGGGTTGAACTCGCACGACGACCGTCGTGAATCTGAATTGGACGGCGATGCTTCTTCCAT
CAACCGCCGGAAAATCGGCGGCGCCGGATCTGACGTTACGGGACAAAAGGGTTCGAAAGCGACAGACATTCTTCAAAGGG
TGTCTCTTGTGGAGTCTGGGCCCGTTACACCATTGCCAGACAAAAAGTTGCTCTTGTTCATCCTCGATAGAGTTCAAAAG
AAGGATACTTATGGAGTGTACTCTGACCCTGTTGATCCAGAGGAGCTTCCTGATTATCATGAGCTTATCAAGAATCCTAT
GGATTTTACCACATTGCGGGAGAAATTAGAAGCCGGCGCTTACTCTACCTTAGAACAATTTGAGGAAGACGTGTTTTTAA
TATGCACAAACGCTATGGAATACAATTCGTCAGATACTATATATCATCGACAGGCACGAGCAATGCTTGAGCTAGCCAAA
AAGGACTTTGCAGATTTAAGACAAGAAAGTGATGGAGAAGTAGAACCAGTGTCACAGTCACAACAACTGCCTAAAGTTGT
CAAAAGAGGCCGTCCTCCAGGCTCAGGCCTTAAGAAACATTCTGAGCCATTTTTAACTGACCGGACTATTTCTGAGAGCT
CAGCTGATGCAGCAGCAGCACACACTCCTGGTGGAGACGGCTCTAGATTAACCGGCGCTTACAATCTAAGAAGAACACCT
CCTTCCGTTAGAACCAACCATTACAGCGAGAACCAAAGTGGCTTGTTGATTGATTGGGAGAAGGAGTTCCCACCTTCGGT
TGTGAAGGCCGTCAACAAATACGGGATGAAGAATGTGGACGAGAACAGGCGAGATTCTTACTTCCTGGACATCTCTCCTT
CTTCGCAAGAAGCTTCGGTTTGTACAAGTCTTGAGGATGGTTTGAAACAGTTAACTCCAGTTGGGTTGAATACTGAATAT
GGCTACGCTAGGAGTCTAGCAAGATATGCTGCAAATCTTGGTCCTGTTGCTTGGAGACTTGCCAGCAAGAGGATTGAGAC
AGTGTTACCAAGTGGAACCGAGTTTGGTCCCGGTTGGGTTGGAGAGAAGCCAGAAGCTCCTCAGCAGCAAAAGTGTTCGA
ATGACTTGGCATCTGAAAGCATACATTCTTCCAAAGAAAGCAAAGAGAGTGCATCAGCTGCTCGCTTGTTGAATCAAAAA
ACTGTTAAGTCAGAACCGCTGATCAATCCTGAGAGCAACGGTCTACTCCGTGGCTGCAGAGGAGTAAACCAGATGCTGGA
AACTGCTGCTTTCTCGCGACAAGGCTTGTCGCCTAACACAAAACCGGAACTAAACCGGTTTCACCCTGATCTCAACGCTA
AGCTCGTCTCACCAAACTCACCGGTCTCTAACCTTCAGGCAGGTTCATCCCAGCAGCATCCGGATTTGGCGCTACAGCTC
TAA