Details for Chinese cabbage Locus Brara.G03432

Position : A07 ( 5`- 25873608 .. 25875911 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03432

Protein [Map View]
MRCFSCLDTRTKDMRINIDTTSYLTSGSSVDTRSDATGGGAGSKSGILVNGKVNSPKPGGGARSFTFKELAAATKNFREV
NMIGRGGFGSVYKGRLYSGQVVAIKQLNPDGNQGNQEFKVEVRMLSVFHHPNLVTLIGYCTSGAQRLLVYEYMPMGSLED
HLYDLEPDQSPLSWNTRMKIAVGAARGMEYLHCKISPSVIYRDLKSANILLDRDFSPKLSDFGLAKDGPVGNRTHVSTRI
MGTYGYCAPEYAMSGKLTIKSDIYCFGVVLLELITGRKVIDLNKPKGEQYLVAWARPYLKDPTKFGQLVDPLLRGKYPKR
CLSCAISITEMCLNEEANRRPQIGDVVVAFEYIAAQRKSYEEKRMARKSTDSDRSRGERKQSF*

DNA
ATGAGGTGTTTCTCTTGTCTCGACACACGAACCAAGGATATGAGAATCAACATTGATACCACATCTTACCTAACCAGTGG
TTCCTCAGTTGATACAAGAAGCGATGCAACAGGAGGAGGAGCAGGGTCGAAATCTGGCATTTTAGTTAATGGGAAAGTGA
ATAGCCCTAAACCAGGCGGTGGCGCAAGGAGTTTCACGTTCAAGGAGTTAGCCGCCGCAACTAAGAATTTCCGGGAGGTG
AACATGATCGGAAGAGGAGGGTTCGGTAGTGTCTACAAGGGACGTTTATATTCAGGACAAGTTGTGGCGATCAAGCAGTT
AAACCCAGATGGGAATCAAGGAAATCAAGAATTCAAAGTCGAGGTTCGCATGCTTAGCGTCTTCCATCATCCAAACCTAG
TAACTTTAATCGGTTACTGTACTTCTGGTGCCCAGAGACTTCTTGTTTATGAATACATGCCAATGGGTAGCTTAGAAGAT
CATCTTTATGATCTTGAGCCTGATCAGAGTCCTTTAAGCTGGAACACTCGAATGAAAATAGCTGTTGGTGCAGCTCGTGG
GATGGAGTATCTTCATTGTAAAATAAGCCCATCAGTGATATACCGTGATTTGAAGTCCGCAAACATTTTGTTAGACAGAG
ACTTTAGTCCCAAGCTATCTGACTTTGGACTTGCTAAAGACGGTCCTGTCGGTAACAGAACACATGTGTCGACTAGGATC
ATGGGTACGTACGGATACTGTGCTCCAGAATACGCCATGAGCGGCAAGCTAACCATCAAATCAGATATATACTGCTTTGG
TGTTGTGTTACTCGAGCTTATTACTGGTAGGAAAGTTATTGATTTGAATAAACCAAAGGGAGAGCAGTACCTTGTTGCAT
GGGCTCGGCCGTATCTCAAGGACCCTACGAAATTTGGACAACTTGTGGACCCGTTGCTGCGTGGAAAGTACCCTAAGAGG
TGTCTTAGTTGCGCGATATCTATCACCGAGATGTGTCTGAACGAGGAAGCGAACCGACGTCCGCAAATAGGTGATGTCGT
GGTGGCTTTTGAGTATATAGCTGCCCAGAGAAAATCTTACGAAGAGAAAAGAATGGCTCGCAAGTCTACGGACTCTGACC
GGTCAAGAGGAGAAAGAAAACAGAGTTTCTAA