Details for Chinese cabbage Locus Brara.G03418

Position : A07 ( 5`- 25801259 .. 25802017 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03418

Protein [Map View]
MAATSSSIGAHVRSTSWPENVHPLSRSIEDHLLILKKSPESACRKLGVLKNMYEVVEVFLRFQSTKTQKAFLEDVSDGFL
EVLDICYTIRDVLMEVKEQVRELESSLRRRVIRSKSGGDHDAFLTREIDAYVFKRRVLSRKIGKQLKMKINKKKKDCGGA
INVMKKVKETSFDVLVSLLMEVVTMNHKQISRSGCRGIMSRMFNKKNQEVEGDELKKLRETEQMIESTEGELECVYKKLL
KTRVSLLNMLTH*

DNA
ATGGCTGCTACTTCATCATCAATTGGTGCACACGTGCGTTCAACAAGCTGGCCCGAAAACGTTCATCCTCTGTCACGATC
CATCGAAGATCATCTTCTGATACTTAAGAAAAGTCCAGAGTCTGCTTGTCGGAAACTCGGAGTTTTAAAGAACATGTACG
AGGTGGTCGAAGTTTTCCTCCGTTTTCAATCGACCAAAACTCAAAAAGCGTTTCTAGAAGATGTCTCCGACGGGTTTCTC
GAGGTTCTTGATATATGTTACACGATCAGAGACGTTTTGATGGAAGTAAAAGAGCAAGTCAGAGAGCTTGAGTCGAGCTT
GAGGAGGAGAGTGATCAGAAGCAAATCAGGAGGAGATCATGATGCTTTCTTGACACGTGAGATCGACGCATACGTGTTTA
AGAGAAGAGTCTTGAGCAGAAAGATTGGCAAGCAGTTGAAGATGAAGATTAATAAGAAGAAGAAAGATTGTGGAGGTGCC
ATCAATGTGATGAAGAAAGTTAAGGAGACGAGCTTCGATGTTCTTGTTTCTTTGTTGATGGAAGTGGTGACGATGAATCA
TAAGCAGATATCAAGAAGTGGTTGTAGAGGAATCATGTCGAGGATGTTTAACAAGAAGAATCAAGAAGTTGAAGGTGATG
AGCTGAAGAAGTTGAGAGAAACAGAGCAAATGATTGAATCAACAGAAGGAGAGTTGGAGTGTGTGTATAAGAAATTGTTG
AAGACGAGAGTTTCTCTTCTTAACATGCTTACTCATTGA