Details for Chinese cabbage Locus Brara.G03416

Position : A07 ( 5`- 25797483 .. 25798733 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03416

Protein [Map View]
MGGGGGITYKGVTVHTPKTWHTVAGKGLCGVMWFWILYRAKQDGPVVMGWRHPWDGHGDHGHGDHH*

DNA
ATGGGCGGAGGAGGAGGTATAACATACAAGGGAGTCACCGTGCACACTCCCAAGACGTGGCACACCGTCGCCGGAAAGGG
CTTGTGCGGCGTTATGTGGTTCTGGATTTTGTACAGAGCAAAGCAAGATGGTCCGGTAGTTATGGGATGGAGGCACCCGT
GGGATGGCCATGGTGATCATGGTCACGGAGATCATCACTAG