Details for Chinese cabbage Locus Brara.G03410

Position : A07 ( 5`- 25778261 .. 25782257 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03410

Protein [Map View]
MLKAFAHHARSQILAFVTVPAIHFRFTRRLRLNILRKSSSSSLLLLNEAFSNRRVSNSRRHSSSSSSSSSRPSSAIMGSS
SALGELLHYPSARRDDSVVEDYHGVKIADPYRWLEDPDAEEVKEFVESQVKLTDSVLAKCETKEKLRENITALFDHPRYE
SPFRRGDKYFYFHNTGLQAQDVLYMQDDLDAEPEVLLDPNTLSDDGTVALNTFSVSEDAKYLAYGLSSSGSDWVTIKLIK
IEDKKVEPDTLSWVKFSGITWTHDSKGFFYGRYPAPKDGEGIDAGTETNSNLYHELYYHFIGTDQSQDILCWRDSENPKY
MFGAEVTDDGKFLIMTIEEGCDPVNKLYYCDLSSLSGGLESFRGSSSFLPFIKLVDTLDAQYNVISNDETLFTFLTNKDA
PKYKLVRVDLKEPNSWTDVVEEHEKDVLASACAVNGNQLVTCYMSDVKHILQIRDMKSGSLLHQLPLDIGSVSDVSARRK
DDTFFFSFTSFLTPGVIYKCDLANEAPEVKVFREVAVPGFDREAFQATQVFYPSKDGTKIPMFIVAKKDIKLDGSHPCLV
YAYGGFNISITPSFSASRIVLSKHLGAVFCIANIRGGGEYGEEWHKAGSLANKQNCFDDFISGAEYLVSAGYTQPSKLCI
EGGSNGGLLIGACINQRPDLYGCALAHVGVMDMLRFHKFTIGHAWTTDYGCSENEEEFHWLIKYSPLHNVKRPWEQQTGN
SVQYPSTMLLTADHDDRVVPLHSLKLLATLQHVLCTSLENSPQTNPIIGRIEVKAGHGAGRPTKKMIDEAADRYSFMAKM
VNAPWTE*

DNA
ATGCTGAAAGCGTTTGCACATCACGCGCGTTCTCAAATTCTCGCGTTTGTTACAGTCCCAGCAATCCATTTCCGCTTCAC
GCGCCGCCTCCGTTTAAATATCTTGCGCAAATCTTCTTCTTCTTCTCTTCTCCTCCTCAACGAAGCCTTCTCAAATCGAC
GCGTGTCTAATTCTCGTCGTCACTCCTCGTCGTCTTCTTCTTCTTCTTCCCGTCCCAGCTCAGCGATCATGGGATCTTCT
TCGGCGCTAGGCGAGCTACTACACTATCCTTCGGCTCGGCGCGATGACTCCGTCGTCGAGGATTATCACGGCGTTAAAAT
CGCAGATCCGTATCGTTGGTTAGAGGATCCTGATGCTGAAGAGGTGAAGGAGTTCGTCGAGAGCCAAGTGAAACTGACTG
ATTCCGTGCTTGCAAAATGCGAGACGAAGGAGAAGCTTCGTGAGAATATAACGGCTCTGTTTGATCATCCGCGCTACGAG
TCACCGTTTAGGCGAGGGGATAAGTACTTTTACTTCCACAACACCGGCCTACAAGCCCAGGATGTGTTGTATATGCAGGA
TGACTTGGACGCTGAGCCAGAGGTTTTGCTTGATCCGAACACTCTTAGTGATGATGGAACAGTGGCTTTAAACACCTTTT
CTGTTAGCGAGGATGCTAAGTACTTGGCCTATGGTCTTAGTTCGAGTGGTAGTGACTGGGTGACGATTAAGCTGATCAAG
ATTGAAGATAAAAAAGTGGAGCCTGATACTTTATCATGGGTTAAGTTCAGTGGGATTACATGGACGCACGATAGTAAAGG
ATTTTTCTATGGTCGCTACCCTGCCCCTAAGGATGGAGAGGGTATCGATGCTGGGACCGAGACTAACTCCAACCTATATC
ATGAGTTGTATTACCATTTCATTGGGACAGATCAGTCTCAAGATATCTTGTGCTGGAGAGATTCTGAGAATCCCAAGTAT
ATGTTCGGAGCTGAAGTCACTGACGATGGGAAGTTTCTAATCATGACCATTGAAGAGGGTTGTGACCCTGTCAACAAGTT
GTACTACTGCGATCTGTCTTCACTTTCTGGAGGTCTTGAAAGTTTCAGAGGAAGCAGCAGTTTTCTTCCGTTCATTAAGC
TTGTTGACACACTTGACGCACAATATAATGTTATCTCAAATGATGAGACTCTGTTTACTTTCCTGACAAACAAAGATGCC
CCTAAGTACAAATTAGTCCGGGTTGATCTGAAGGAACCAAACAGCTGGACTGATGTTGTTGAAGAACATGAAAAGGATGT
CCTAGCGTCGGCTTGTGCAGTCAATGGGAATCAACTGGTCACATGCTATATGAGCGATGTTAAGCATATTCTGCAAATTA
GGGACATGAAATCTGGCTCTTTGCTTCACCAATTACCTCTAGATATTGGTTCAGTATCTGATGTTTCTGCTCGGCGCAAG
GACGATACCTTCTTCTTTAGCTTTACTAGCTTCCTCACTCCCGGTGTGATATACAAGTGTGACTTAGCCAATGAAGCTCC
AGAAGTTAAGGTATTCCGAGAGGTCGCTGTACCCGGATTTGACAGGGAGGCGTTTCAAGCCACTCAGGTCTTCTATCCTA
GCAAGGATGGAACGAAGATACCAATGTTTATTGTGGCGAAAAAAGATATCAAGCTAGATGGATCACACCCATGTTTGGTC
TATGCATATGGTGGTTTTAACATAAGCATAACACCATCTTTCAGCGCAAGTCGCATTGTGCTTAGCAAGCATCTCGGTGC
TGTTTTCTGCATTGCAAACATTCGAGGTGGTGGGGAGTATGGGGAGGAATGGCACAAAGCGGGTTCACTTGCCAACAAGC
AGAACTGCTTCGATGACTTCATATCTGGGGCAGAGTATCTCGTGTCCGCTGGTTATACACAACCCAGCAAGCTGTGTATC
GAAGGTGGCAGTAACGGTGGACTCCTGATCGGTGCTTGCATTAATCAGAGACCCGACCTTTATGGTTGTGCTTTGGCTCA
CGTGGGTGTCATGGATATGCTACGGTTTCACAAGTTCACCATAGGCCATGCATGGACTACTGACTATGGTTGTTCCGAGA
ATGAAGAAGAGTTTCATTGGCTGATAAAGTACTCGCCTCTACATAATGTGAAGAGACCATGGGAGCAACAAACTGGTAAT
TCAGTTCAGTACCCGTCAACCATGTTACTGACAGCTGATCACGATGACAGAGTTGTCCCGCTTCACTCTCTGAAGTTGCT
TGCGACGTTGCAGCACGTGCTGTGCACAAGCTTAGAGAACAGTCCACAGACAAACCCCATTATTGGTCGTATTGAAGTTA
AGGCCGGCCACGGAGCTGGTCGCCCAACCAAAAAGATGATTGATGAGGCGGCTGATCGTTATTCGTTCATGGCAAAGATG
GTGAATGCTCCATGGACTGAGTAA