Details for Chinese cabbage Locus Brara.G03409

Position : A07 ( 5`- 25769502 .. 25772892 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03409

Protein [Map View]
MGYYNNVFDGCNDQTDIGAVMRNGREVILQAYNWESHKHNWYKNLDAKVPDISKSGFTSAWLPPPSQSLAPEGYLPQDLY
SLNSAYGSEHLLKSLLGKMKLYKVRAMADIVINHRIGTTRGHGGMYNRYDGSSLPWDEHAVTSCTGGKGNRSTGDNFNGV
PNVDHTQHFVRKDIIGWLRWLRNTVGFQDFRFDFARGYSAQYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQR
IINWIDATGQRSAAFDFTTKGILQEAVMGQYWRLRDAQGKPPGVMGWWPSRSVTFLDNHDTGSTQAHWPFPSHHIMEGYA
YILTHPGIPCVFYDHFYDWGSSIHDQIVKLIDVRRRQDIHSRSTIRILEAKSNLYAAIVGEKLCMKLGDASWCPSGREWT
LATSGHRYAVWHK*

DNA
ATGGGTTACTATAACAATGTCTTTGATGGATGCAATGACCAAACTGATATCGGTGCGGTTATGCGTAATGGAAGGGAAGT
CATTCTCCAGGCATATAACTGGGAGTCTCACAAACACAACTGGTACAAAAACTTGGACGCAAAAGTTCCAGACATCTCAA
AATCAGGCTTCACTTCCGCATGGCTCCCACCACCATCTCAGTCTCTCGCACCAGAAGGTTACCTTCCACAGGACCTTTAC
TCGCTAAACTCAGCGTACGGCTCCGAGCACCTCTTGAAATCCTTGCTTGGCAAGATGAAACTGTACAAAGTCAGAGCCAT
GGCTGATATAGTCATCAACCATCGCATTGGCACTACGAGAGGACACGGTGGAATGTATAACCGCTACGATGGGAGCTCGC
TACCATGGGATGAACACGCTGTTACTTCGTGTACAGGAGGAAAAGGGAATCGAAGCACGGGAGATAATTTCAATGGAGTT
CCGAATGTTGATCATACTCAACACTTTGTTAGGAAAGATATTATTGGTTGGCTTCGTTGGTTGCGTAATACAGTTGGGTT
TCAGGACTTTCGTTTTGACTTTGCTAGAGGCTATTCAGCTCAGTATGTGAAGGAATACATAGGAGCAGCGAAACCGTTGT
TCTCGGTTGGTGAATGTTGGGATTCTTGTAACTACAATGGTCATGGTCTTGACTATAATCAAGATAGCCATAGACAGCGT
ATAATCAATTGGATTGATGCCACGGGACAGCGTTCAGCTGCATTTGACTTCACGACTAAAGGAATCCTGCAGGAAGCTGT
GATGGGACAGTATTGGCGTTTACGTGATGCACAAGGGAAGCCACCGGGAGTAATGGGATGGTGGCCTTCAAGATCTGTCA
CGTTCCTTGATAACCACGACACTGGTTCTACACAGGCTCACTGGCCGTTCCCTTCACACCATATTATGGAGGGCTATGCA
TATATACTTACTCATCCAGGCATCCCATGTGTGTTCTATGATCACTTCTACGATTGGGGAAGCTCCATTCATGACCAGAT
TGTCAAACTGATTGATGTTAGGAGGCGACAAGATATTCATAGTAGGTCAACGATCCGTATTCTGGAAGCAAAGTCTAACT
TATACGCAGCCATTGTTGGTGAGAAACTCTGCATGAAGCTTGGAGACGCCTCTTGGTGTCCTTCTGGTAGAGAATGGACT
CTAGCAACAAGTGGCCATCGCTATGCCGTCTGGCACAAGTAA