Details for Chinese cabbage Locus Brara.G03406

Position : A07 ( 5`- 25761267 .. 25763655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03406

Protein [Map View]
MSSGNESTPSQGTIETTATSPAKVKEYPEPLASHEDVVKDLSLFWDTLRRFHSILATKFMIPVIGGKELDLHVLYVEVTR
RGGYEKVVTEKKWREVGGVFRFSATTTSASFVLRKHYLNLLFHYEQVHLFNARGPLLHPTATFHAKDPSTSKEMALVEYT
PPSIGYTSSHAPPSQGSSSFTAIGTIEGKFDCGYLVKVKLGSEILNGVLYHSAQPGPSTPTADPIGAVVPYVEAGRRRRR
SGKRRRSRRREDPNYPKPNRSGYNFFFAEKHCKLKSLYPNKEREFTKIIGESWTNLSAEERLVYQKIGLEDKERYQRELN
EYREKLRLSAVDEANGRVV*

DNA
ATGTCTTCTGGAAATGAATCGACGCCGTCTCAGGGGACGATAGAAACGACTGCCACGTCTCCGGCGAAGGTTAAAGAGTA
CCCTGAACCTTTGGCTTCACATGAAGATGTTGTGAAAGATCTTTCTCTCTTCTGGGATACTCTCAGGCGGTTTCACTCCA
TACTGGCCACCAAATTCATGATTCCTGTGATTGGTGGAAAAGAACTGGACTTGCATGTTTTGTATGTGGAAGTCACGAGG
AGGGGAGGTTACGAAAAGGTTGTGACTGAGAAAAAATGGAGGGAAGTTGGAGGAGTGTTTAGATTCTCTGCGACTACAAC
AAGTGCTTCTTTTGTCTTAAGGAAACATTATCTCAATCTTCTCTTTCATTACGAACAAGTTCATCTCTTCAATGCTCGTG
GTCCTCTTCTTCATCCCACAGCTACATTTCATGCCAAGGATCCTTCAACGAGCAAGGAGATGGCTCTCGTCGAATACACT
CCTCCAAGCATAGGTTATACTAGTTCTCATGCTCCTCCTTCCCAAGGTTCGTCGAGTTTCACAGCCATAGGTACAATTGA
AGGCAAATTCGACTGTGGTTATCTGGTTAAAGTTAAGTTGGGCTCAGAGATTCTTAATGGCGTGCTTTACCACTCAGCCC
AGCCCGGCCCATCAACACCAACTGCTGATCCGATAGGTGCCGTTGTACCATACGTGGAAGCTGGTAGGAGACGACGTCGT
TCTGGTAAAAGACGCAGAAGCAGGCGCAGAGAAGACCCGAATTACCCGAAACCAAACCGGAGCGGTTACAATTTCTTCTT
TGCTGAGAAACATTGCAAGCTCAAGTCTCTTTACCCAAACAAGGAACGAGAGTTTACGAAGATCATAGGCGAGTCATGGA
CCAATCTGTCAGCTGAGGAACGACTGGTTTACCAGAAGATTGGATTGGAGGACAAGGAGAGGTATCAGAGGGAGTTGAAC
GAGTACAGAGAAAAGTTAAGGCTCAGTGCTGTTGACGAGGCAAACGGCAGGGTTGTCTAG