Details for Chinese cabbage Locus Brara.G03405

Position : A07 ( 5`- 25758016 .. 25758528 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03405

Protein [Map View]
MASVTSATVAFPCFTGLKLAVNAKPTAVSTAAIKSPSKAAPKLSVKSSLKDFGVMAVAAAASIALAGNAMAIEILLGSDD
GGLVFVPSDFTVAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDASKISMDEQALLNGAGETYEVTLTEPGSYSFYCVPHQG
AGMVGKLTVN*

DNA
ATGGCATCAGTTACATCAGCTACCGTTGCATTCCCATGTTTTACCGGCCTCAAGCTCGCCGTCAACGCCAAACCCACGGC
GGTATCCACCGCCGCCATCAAATCTCCCTCCAAAGCGGCGCCTAAGCTATCCGTGAAGTCTTCTCTTAAAGATTTTGGCG
TCATGGCCGTTGCAGCAGCAGCTTCCATCGCTTTGGCCGGGAATGCGATGGCCATTGAGATACTCTTAGGATCTGATGAT
GGTGGTCTTGTTTTCGTACCAAGCGACTTCACGGTGGCTAAAGGAGAGAAGATCGTGTTCAAGAACAACGCAGGGTACCC
ACACAACGTGGTGTTCGACGAAGACGAGATCCCTAGTGGCGTGGACGCGAGCAAGATCTCGATGGACGAGCAAGCGCTTC
TCAATGGTGCGGGAGAGACGTACGAGGTTACGTTGACAGAACCTGGCTCTTACAGTTTCTACTGTGTGCCCCACCAGGGA
GCTGGTATGGTTGGAAAGCTCACCGTCAACTAA